DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment azot and Aif1

DIOPT Version :9

Sequence 1:	NP_610336.1	Gene:	azot / 35751	FlyBaseID:	FBgn0033238	Length:	148	Species:	Drosophila melanogaster
Sequence 2:	XP_006256123.1	Gene:	Aif1 / 29427	RGDID:	61924	Length:	240	Species:	Rattus norvegicus

Alignment Length:	54	Identity:	19/54 - (35%)
Similarity:	29/54 - (53%)	Gaps:	0/54 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    92 FDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFVNMM 145
            ||.:.||.|....||.:...|||..:..||:::|||.....:...:|.:|:.||
  Rat   150 FDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMM 203

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
azot	NP_610336.1	PTZ00184	1..148	CDD:185504	19/54 (35%)
		EFh	12..72	CDD:238008
		EFh	84..146	CDD:238008	19/54 (35%)
Aif1	XP_006256123.1	EFh	150..203	CDD:238008	17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910