DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and cam1

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_593340.1 Gene:cam1 / 2543039 PomBaseID:SPAC3A12.14 Length:150 Species:Schizosaccharomyces pombe


Alignment Length:146 Identity:71/146 - (48%)
Similarity:107/146 - (73%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPE 67
            :::.|:.....:.|.:.|:|.:|.|||.|:.||:|:||:.|..||:|.||||||::|||:|...|
pombe     5 NLTDEQIAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDFTE 69

  Fly    68 FCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQ 132
            |..::.|||:||::|:|:||||::||||.|||||..||.:|.|:||.:||.:|:.:||||.|.|.
pombe    70 FLTMMARKMKDTDNEEEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADMIREADTDG 134

  Fly   133 DNHLNYEEFVNMMTMR 148
            |..:|||||..:::.:
pombe   135 DGVINYEEFSRVISSK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 71/144 (49%)
EFh 12..72 CDD:238008 29/59 (49%)
EFh 84..146 CDD:238008 35/61 (57%)
cam1NP_593340.1 PTZ00184 5..150 CDD:185504 71/144 (49%)
EFh 13..75 CDD:238008 29/61 (48%)
EFh 86..148 CDD:238008 35/61 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.