DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and cam2

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_594877.1 Gene:cam2 / 2542611 PomBaseID:SPAC29A4.05 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:138 Identity:48/138 - (34%)
Similarity:79/138 - (57%) Gaps:4/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFC 69
            |.|:...:.:.|.:.|.|.:|.|.:..:..|:|:||....|||:..:.||:    ..:|...:|.
pombe     4 SKEQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAELAKLSNEL----GDAIDEKKFM 64

  Fly    70 NVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDN 134
            :.:..|:|:|..|:|..:|||:|||||:|||.|.:..:....||.||||:|::.|::|.|.....
pombe    65 SFVSNKLRETESEEEYIKAFRVFDKDNSGYIETAKFADYMKTLGEKLSDNEVQLMVQEADPTNSG 129

  Fly   135 HLNYEEFV 142
            ..:|.:||
pombe   130 SFDYYDFV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 48/138 (35%)
EFh 12..72 CDD:238008 16/59 (27%)
EFh 84..146 CDD:238008 26/59 (44%)
cam2NP_594877.1 FRQ1 1..143 CDD:227455 48/138 (35%)
EFh 10..105 CDD:298682 33/98 (34%)
EFh 79..141 CDD:238008 26/59 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.