DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CG30378

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster


Alignment Length:134 Identity:41/134 - (30%)
Similarity:80/134 - (59%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKM 76
            |.:.|.:.||:..|.::.:::..|:||||....:||:..:.||.:::..|.:...:|..|:.:::
  Fly    13 IREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQFKDFLYVMSKRL 77

  Fly    77 RDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEF 141
            .:.|....|::||:|||:......|..|::.|.|.||.|:|:::|.|:.::.|.|:|..:::.||
  Fly    78 EEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDIDQDKDGKISFNEF 142

  Fly   142 VNMM 145
            |..|
  Fly   143 VTAM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 41/134 (31%)
EFh 12..72 CDD:238008 16/59 (27%)
EFh 84..146 CDD:238008 23/62 (37%)
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 41/134 (31%)
EFh 12..74 CDD:238008 17/60 (28%)
EFh 86..147 CDD:238008 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.