DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment azot and Myl6b

DIOPT Version :9

Sequence 1:	NP_610336.1	Gene:	azot / 35751	FlyBaseID:	FBgn0033238	Length:	148	Species:	Drosophila melanogaster
Sequence 2:	NP_758463.1	Gene:	Myl6b / 216459	MGIID:	1917789	Length:	207	Species:	Mus musculus

Alignment Length:	133	Identity:	39/133 - (29%)
Similarity:	74/133 - (55%)	Gaps:	5/133 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGS--IVAPEFCNVI--LR 74
            :.|.:.|:..:|.|...:...::||||:.|.:|||..::....:|...|  :....|..::  :.
Mouse    70 EAFELFDRVGDGKILYSQCGDLMRALGQNPTNAEVLKVLGNPKNEELKSRRVDFETFLPMLQAVA 134

  Fly    75 KMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYE 139
            |.||....::..|..|:|||:.||.:...||::|.|.||.|::::|:|.::..:: |.:..:|||
Mouse   135 KNRDQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHE-DSNGCINYE 198

  Fly   140 EFV 142
            .|:
Mouse   199 AFL 201

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
azot	NP_610336.1	PTZ00184	1..148	CDD:185504	39/133 (29%)
		EFh	12..72	CDD:238008	15/59 (25%)
		EFh	84..146	CDD:238008	21/59 (36%)
Myl6b	NP_758463.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..50
		PTZ00184	57..206	CDD:185504	39/133 (29%)
		EFh	67..131	CDD:298682	15/60 (25%)
		EFh	67..95	CDD:197492	5/24 (21%)
		EFh	150..204	CDD:238008	20/53 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1470794at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010