powered by:
Protein Alignment azot and AIF1
DIOPT Version :9
Sequence 1: | NP_610336.1 |
Gene: | azot / 35751 |
FlyBaseID: | FBgn0033238 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005248927.1 |
Gene: | AIF1 / 199 |
HGNCID: | 352 |
Length: | 186 |
Species: | Homo sapiens |
Alignment Length: | 41 |
Identity: | 13/41 - (31%) |
Similarity: | 21/41 - (51%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 LKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFVNMM 145
||.:...|||..:..||:::|.|.........:|.:|:.||
Human 136 LKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMM 176
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
azot | NP_610336.1 |
PTZ00184 |
1..148 |
CDD:185504 |
13/41 (32%) |
EFh |
12..72 |
CDD:238008 |
|
EFh |
84..146 |
CDD:238008 |
13/41 (32%) |
AIF1 | XP_005248927.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.