DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and E02A10.3

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001343832.1 Gene:E02A10.3 / 179722 WormBaseID:WBGene00008453 Length:283 Species:Caenorhabditis elegans


Alignment Length:147 Identity:46/147 - (31%)
Similarity:78/147 - (53%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVA 65
            :|..|.||.......|.:.|.|..|||...|:...|:.||.:....|:..:|:|||..||..|..
 Worm   128 LEGYSEEELQEYRQVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDF 192

  Fly    66 PEFCNVILRK--MRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREY 128
            .||| |::|:  |:.:|..:.::|.|.:||:..||.|:..:.:.:...||....:..::|:..|.
 Worm   193 DEFC-VVMRRLTMKKSNWNEVVKECFTVFDRSENGGISKKDFRFILRELGDITDNQIIDEIFNEA 256

  Fly   129 DLDQDNHLNYEEFVNMM 145
            |:|.:..::|:||..|:
 Worm   257 DVDGNGVIDYDEFTYMV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 46/147 (31%)
EFh 12..72 CDD:238008 21/59 (36%)
EFh 84..146 CDD:238008 17/62 (27%)
E02A10.3NP_001343832.1 EFh_PEF 132..273 CDD:330173 44/141 (31%)
EF-hand motif 140..167 CDD:320054 8/26 (31%)
EF-hand motif 175..203 CDD:320054 12/28 (43%)
EF-hand motif 208..241 CDD:320054 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.