DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and cal-1

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001256428.1 Gene:cal-1 / 179715 WormBaseID:WBGene00000285 Length:180 Species:Caenorhabditis elegans


Alignment Length:146 Identity:64/146 - (43%)
Similarity:100/146 - (68%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVA 65
            ::.::.||.....:.|.:.|||..|.|::||:.:.:|:||:.|.:.|:..||||||.:|||.|..
 Worm    34 IKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDIDGNGQIEF 98

  Fly    66 PEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDL 130
            ||||.::.|.|::|:.| .:|||||:||||.||.||..|.:.....:|::.|::|::|||:|.|:
 Worm    99 PEFCVMMKRMMKETDSE-MIREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDV 162

  Fly   131 DQDNHLNYEEFVNMMT 146
            |.|..::|||||.||:
 Worm   163 DGDGEIDYEEFVKMMS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 64/146 (44%)
EFh 12..72 CDD:238008 27/59 (46%)
EFh 84..146 CDD:238008 30/61 (49%)
cal-1NP_001256428.1 EFh_PEF 36..177 CDD:330173 62/141 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53419
OrthoDB 1 1.010 - - D600030at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.