DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Myl3

DIOPT Version :10

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_034989.1 Gene:Myl3 / 17897 MGIID:97268 Length:204 Species:Mus musculus


Alignment Length:135 Identity:43/135 - (31%)
Similarity:76/135 - (56%) Gaps:7/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDNEG--AITSKEMAVVIRALGRQPNDAEVQSMINEVDSEG-NGSIVAPE-FCNVI-- 72
            :.|.:.|:..:|  .||..:...|:||||:.|..|||..::.:...|. |..::..| |..::  
Mouse    65 EAFLLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFETFLPMLQH 129

  Fly    73 LRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLN 137
            :.|.:||...::..|..|:|||:.||.:...||::|...||.:|::||:|:::...: |.:..:|
Mouse   130 ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQE-DSNGCIN 193

  Fly   138 YEEFV 142
            ||.||
Mouse   194 YEAFV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 43/135 (32%)
Myl3NP_034989.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
PTZ00184 53..203 CDD:185504 43/135 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.