DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and cal-3

DIOPT Version :10

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_500421.2 Gene:cal-3 / 177143 WormBaseID:WBGene00000287 Length:234 Species:Caenorhabditis elegans


Alignment Length:146 Identity:57/146 - (39%)
Similarity:92/146 - (63%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVA 65
            :..::.||.....:.|.:.|||..|.|:.||:.|.:||||:.|.:.::..:|::||.:|||.:..
 Worm    90 ISQLTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHDVDLDGNGQVEF 154

  Fly    66 PEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDL 130
            ||||.::.|.|::|:.| .:||||:|||:|.||.||..|.|.....:|:...:.|:|||:.|.|.
 Worm   155 PEFCVMMKRIMKETDSE-MIREAFKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVDC 218

  Fly   131 DQDNHLNYEEFVNMMT 146
            |.:..::|||||.:.:
 Worm   219 DGNGEIDYEEFVKIFS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 57/146 (39%)
cal-3NP_500421.2 PTZ00184 92..232 CDD:185504 57/140 (41%)

Return to query results.
Submit another query.