DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and mlc-3

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_741145.1 Gene:mlc-3 / 175768 WormBaseID:WBGene00003371 Length:153 Species:Caenorhabditis elegans


Alignment Length:135 Identity:36/135 - (26%)
Similarity:71/135 - (52%) Gaps:4/135 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEV-QSMINEVDSEGNGSIVAPEFCNVI-- 72
            ::.:.|.:.|::.:|.|...::..|.||.|.:|..|.| ::...|...:|...:...|:..:.  
 Worm     8 VLKEIFNLYDEELDGKIDGTQVGDVARAAGLKPTQAMVTKAAGQEFKRKGEKRLTFEEWLPMYEQ 72

  Fly    73 LRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLN 137
            |.|.::.....:..|..::|||:..|.|...||:::..|||.:||.||.:|:::..: |.:..:.
 Worm    73 LAKEKEQGTYADFYEGLKVFDKEETGKILAAELRHILLALGERLSADEADELLKGVE-DGEGMVK 136

  Fly   138 YEEFV 142
            ||:|:
 Worm   137 YEDFI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 36/135 (27%)
EFh 12..72 CDD:238008 14/60 (23%)
EFh 84..146 CDD:238008 20/59 (34%)
mlc-3NP_741145.1 EF-hand_7 9..70 CDD:290234 14/60 (23%)
EFh 90..142 CDD:298682 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.