DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CALML6

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:150 Identity:53/150 - (35%)
Similarity:78/150 - (52%) Gaps:9/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAP 66
            |.:|.|:.......|.:.|::..|.:.:.|:..::..||..|..:|:.||..:||.:..|..   
Human    50 ERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFF--- 111

  Fly    67 EFCNVILRKM-----RDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIR 126
             .|:..|..|     :..|.|.|||.|||:|||:..|||....||.|....|..|::.|.|:|::
Human   112 -NCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMK 175

  Fly   127 EYDLDQDNHLNYEEFVNMMT 146
            |.|.|.|..::|||||.|||
Human   176 EADKDGDRTIDYEEFVAMMT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 52/149 (35%)
EFh 12..72 CDD:238008 14/59 (24%)
EFh 84..146 CDD:238008 30/61 (49%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504 51/148 (34%)
EFh 59..120 CDD:238008 15/64 (23%)
EFh 133..195 CDD:238008 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.