DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment azot and MYL6B

DIOPT Version :9

Sequence 1:	NP_610336.1	Gene:	azot / 35751	FlyBaseID:	FBgn0033238	Length:	148	Species:	Drosophila melanogaster
Sequence 2:	NP_001186558.1	Gene:	MYL6B / 140465	HGNCID:	29823	Length:	208	Species:	Homo sapiens

Alignment Length:	134	Identity:	42/134 - (31%)
Similarity:	72/134 - (53%)	Gaps:	7/134 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMI-NEVDSEGNGSIVAPE----FCNVIL 73
            :.|.:.|:..:|.|...:...|:||||:.|.:|||..:: |....|.....|..|    ....:.
Human    71 EAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVA 135

  Fly    74 RKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNY 138
            :......:||.| |.||:|||:.||.:...||::|.|.||.|::::|:|.::..:: |.:..:||
Human   136 KNRGQGTYEDYL-EGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHE-DSNGCINY 198

  Fly   139 EEFV 142
            |.|:
Human   199 EAFL 202

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
azot	NP_610336.1	PTZ00184	1..148	CDD:185504	42/134 (31%)
		EFh	12..72	CDD:238008	17/62 (27%)
		EFh	84..146	CDD:238008	23/59 (39%)
MYL6B	NP_001186558.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..51
		PTZ00184	58..207	CDD:185504	42/134 (31%)
		EFh	68..132	CDD:298682	17/60 (28%)
		EFh	68..96	CDD:197492	6/24 (25%)
		EFh	150..205	CDD:238008	21/54 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1470794at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	2.010