DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Calb2

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_031612.1 Gene:Calb2 / 12308 MGIID:101914 Length:271 Species:Mus musculus


Alignment Length:162 Identity:38/162 - (23%)
Similarity:68/162 - (41%) Gaps:26/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDTFRILDKDNEGAITSKEMAVVIRAL----------GRQPNDAE-VQSMINEVDSEGNGSI--- 63
            |:.::..|.|..|.|..||:....:.|          .:..|..| ::..:.:.|...:|.|   
Mouse    22 LEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMA 86

  Fly    64 ----VAPEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLS----DDE 120
                :.|...|.:|...:......|..||:|.:|.|.:|||...|||...:.|..|.:    :.:
Mouse    87 ELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPK 151

  Fly   121 LEE----MIREYDLDQDNHLNYEEFVNMMTMR 148
            |:|    ::|.:||:.|..|...|...::.::
Mouse   152 LQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 38/160 (24%)
EFh 12..72 CDD:238008 15/76 (20%)
EFh 84..146 CDD:238008 22/69 (32%)
Calb2NP_031612.1 EFh_HEF_CR 21..268 CDD:320077 38/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.