DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and calml4b

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_021326249.1 Gene:calml4b / 100321746 ZFINID:ZDB-GENE-071009-6 Length:166 Species:Danio rerio


Alignment Length:138 Identity:34/138 - (24%)
Similarity:70/138 - (50%) Gaps:3/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRD 78
            :.|.:.|:..:|.:..:::..|:.:||..|...|:...:.....:.:|.:....|.:::..:::.
Zfish    15 ECFSLYDQKRKGKLKVQDLLTVMSSLGCCPTLPELHRHLLSHKIDKHGELDFSTFLSIMHEQIQQ 79

  Fly    79 TNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEE--- 140
            .|...|:.:|.|:.|.:..|:||..||:...|..|.||.|.|::|::.|..:..|..:.||:   
Zfish    80 ENPRAEILQAVRLTDTEKRGFITAAELRARLTHFGEKLRDQEVDELLSEAGVANDGQIKYEDCER 144

  Fly   141 FVNMMTMR 148
            .|.::|.|
Zfish   145 IVTLLTRR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 33/136 (24%)
EFh 12..72 CDD:238008 10/57 (18%)
EFh 84..146 CDD:238008 21/64 (33%)
calml4bXP_021326249.1 EFh_PEF 1..141 CDD:330173 30/125 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.