DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and zgc:163073

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001082980.1 Gene:zgc:163073 / 100037358 ZFINID:ZDB-GENE-070410-135 Length:213 Species:Danio rerio


Alignment Length:133 Identity:37/133 - (27%)
Similarity:73/133 - (54%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGS--IVAPEFCNVI--LR 74
            :.|::..:...| |:..:...|:||||:.|.:|||.:::.:...|...|  |....|..::  :.
Zfish    77 EAFQLFARSPSG-ISLAQCGDVMRALGQNPTNAEVLNVLGKPKPEEMESKLIDFETFLPMLQQVS 140

  Fly    75 KMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYE 139
            |..::...::..|..|:|||:.||.:...||::|...||.:||:.|:::::...: |.:..:|||
Zfish   141 KSTESGSFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLSEGEVDQLLAGQE-DTNGCINYE 204

  Fly   140 EFV 142
            .|:
Zfish   205 AFI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 37/133 (28%)
EFh 12..72 CDD:238008 16/59 (27%)
EFh 84..146 CDD:238008 20/59 (34%)
zgc:163073NP_001082980.1 PTZ00184 70..212 CDD:185504 37/133 (28%)
EFh 150..211 CDD:238008 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.