DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14764 and R05A10.7

DIOPT Version :9

Sequence 1:NP_001286173.1 Gene:CG14764 / 35749 FlyBaseID:FBgn0033236 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_502715.3 Gene:R05A10.7 / 187597 WormBaseID:WBGene00011024 Length:344 Species:Caenorhabditis elegans


Alignment Length:349 Identity:74/349 - (21%)
Similarity:130/349 - (37%) Gaps:85/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DQQNVVDIGSPGQQLPKTDFSAPATKAEL-------ELSELRGLRRPQDAVTFGSQAGDQKGQRK 143
            |.||...||.      |.|.|...|...|       |:..|..|.:.::.:.|.|...|.     
 Worm    57 DPQNTSIIGK------KFDCSLLDTLENLNLLGETKEVFSLSNLIQNENDLIFASATSDD----- 110

  Fly   144 RITTPYNGTKSNFTIVSYVLEGQAASAILLAQNIAAKLPSEYLLIYDLGVSEEQLRDLGAYCNNS 208
                     ..||::.|:             .:|....|:...::|.||:||..:..|     ..
 Worm   111 ---------HFNFSMDSF-------------HSIRKYYPNHTYILYGLGLSEYYINSL-----PD 148

  Fly   209 RCSVITYDLSEFPSFVADQRTHAYRPIVIKDGLMRARSVLFLENSMRVRGGSAQLRSLQSIVMNP 273
            ......::.|.:||||.....:.::|:::.: |:|...|::..:|             ..:.:.|
 Worm   149 NLEFRQFNTSGYPSFVNTWMHYNFKPLILAE-LLRENPVVWWIDS-------------HLVTIKP 199

  Fly   274 GVGKSAVK--SAGVLGWNTATAVSS---------LTHPKMFDYFESKAEE-FNFLRMVDLDAVFF 326
            .:.::...  |...|..|.::.|||         :.:..:..||.:.:.| ....|....:.:|.
 Worm   200 NIIRNMYDDISTNRLNSNYSSIVSSVLAFHSNFAVLNTDVLGYFPTNSMELLKRQRQAGANNIFV 264

  Fly   327 SDSSLVAEKIMLPWLKCCLTLECIDPIGAQSNGCKFNKKPMFRYSGCHGYDASAFNIVLGLTFQM 391
            ..:|... ||...|:.|.||.:|:.|.|: :..|::........:.|..||.|..||:|...|| 
 Worm   265 PRTSYTM-KIFKWWVLCALTDDCMSPPGS-TTLCEYTSDNFNNSANCFRYDQSILNILLLNDFQ- 326

  Fly   392 DTSEYSLPGDSPRNIFYKESLEQA 415
                     ||.:  |:..:||.:
 Worm   327 ---------DSDK--FFSSNLENS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14764NP_001286173.1 None
R05A10.7NP_502715.3 DUF1647 40..178 CDD:285093 33/158 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160722
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2YQ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I3957
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1248401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103107
Panther 1 1.100 - - O PTHR31389
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1890
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.