DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8728 and QCR2

DIOPT Version :9

Sequence 1:NP_610333.1 Gene:CG8728 / 35748 FlyBaseID:FBgn0033235 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_015517.1 Gene:QCR2 / 856321 SGDID:S000006395 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:55/266 - (20%)
Similarity:103/266 - (38%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 AESAITKVTTLPNGLRIASEPRYGQFCTVGLVIDSGPRYEVAYPSGVSHFLEKLAFNSTVNFPNK 153
            |..|.||::||                  .:.:..|.||  |...||:|.|.:..|.:| |..:.
Yeast    21 ARDAPTKISTL------------------AVKVHGGSRY--ATKDGVAHLLNRFNFQNT-NTRSA 64

  Fly   154 DAILKELEKNGGICDCQSSRDTLIYAASIDSRAIDSVTRLLADVTLRPTLSDQEVS-LARRAVNF 217
            ..:::|.|..||.......|:.:...|:.....:......||||..:......|:: ....|..:
Yeast    65 LKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARY 129

  Fly   218 ELETLGMRPEQEPI--LMDMIHAAAFRDNTLGLPKLCPLENLDHINRNVLMNYLKYHHSPKRMVI 280
            :...    .||.|:  ..|.::|..||.. ||.|.|  .:.::.::...:.::....::.:.:.:
Yeast   130 DYAV----AEQCPVKSAEDQLYAITFRKG-LGNPLL--YDGVERVSLQDIKDFADKVYTKENLEV 187

  Fly   281 AGVGVDHDELVSHVQRYFVEDKAIWETEA----LEDSGPKQV--DTSIAQYTGGLVKEQCEIPIY 339
            :|..|...:|     :.||::..:....|    :..|.||..  :.:..::.|..|         
Yeast   188 SGENVVEADL-----KRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSV--------- 238

  Fly   340 AAAGLP 345
            ||.|:|
Yeast   239 AAIGIP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8728NP_610333.1 PqqL 76..532 CDD:223685 55/266 (21%)
Peptidase_M16 104..253 CDD:279066 34/151 (23%)
Peptidase_M16_C 259..461 CDD:282978 15/93 (16%)
QCR2NP_015517.1 PqqL 1..362 CDD:223685 55/266 (21%)
Peptidase_M16 17..163 CDD:395547 40/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.