DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8728 and CG10588

DIOPT Version :9

Sequence 1:NP_610333.1 Gene:CG8728 / 35748 FlyBaseID:FBgn0033235 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster


Alignment Length:326 Identity:62/326 - (19%)
Similarity:119/326 - (36%) Gaps:68/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ESAITKVTTLPNGLRI-----------------------ASEPRYGQFCTVGLVIDSGPRYEVAY 131
            :|.:.:..||.||||.                       ::|...|:.....:::..|...|...
  Fly    46 DSKLYRALTLSNGLRAMLISDSYIDEPSIHRASRESLNSSTENFNGKLAACAVLVGVGSFSEPQQ 110

  Fly   132 PSGVSHFLEKLAFNSTVNFPNKDAILKELEKNGGICDCQSSRDTLIYAASIDSRAIDSVTRLLAD 196
            ..|::||:|.:.|..:..||.::.....:.|:||..:..:..:...:...:|...:|....|..:
  Fly   111 YQGLAHFVEHMIFMGSEKFPVENEFDSFVTKSGGFSNAHTENEETCFYFELDQTHLDRGMDLFMN 175

  Fly   197 VTLRPTLSDQEVSLARRAVNFELETLGMRPE--QEPILMDMIHAAAFRDNTLGLPKLCPL-ENLD 258
            :...|.:....:|..|.||..|.|...||.|  ::.||..:. :..:...|........| |.:|
  Fly   176 LMKAPLMLPDAMSRERSAVQSEFEQTHMRDEVRRDQILASLA-SEGYPHGTFSWGNYKTLKEGVD 239

  Fly   259 HIN-RNVLMNYLKYHHSPKRMVIA-GVGVDHDELVSHVQRYFVEDKAIWETEALEDSGPKQVDTS 321
            ..: ...|..:.:.|:...|||:| ...:..|||...:.|:..:         :..|....:|.|
  Fly   240 DSSLHKELHKFYRDHYGSNRMVVALQAQLSLDELEELLVRHCAD---------IPTSQQNSIDVS 295

  Fly   322 IAQYTGGL-------------VKEQCEIPIYAAAGLPELAHV-----------ILGFEG----CS 358
            ...|....             |::.|::.:...  ||.:.:.           ::|:||    |:
  Fly   296 QLNYQKAFRDQFYKDVFLVQPVEDVCKLELTWV--LPPMKNFYRSKPDMFISQLIGYEGVGSLCA 358

  Fly   359 H 359
            :
  Fly   359 Y 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8728NP_610333.1 PqqL 76..532 CDD:223685 62/326 (19%)
Peptidase_M16 104..253 CDD:279066 31/173 (18%)
Peptidase_M16_C 259..461 CDD:282978 22/131 (17%)
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 62/326 (19%)
Peptidase_M16 85..214 CDD:279066 28/128 (22%)
Peptidase_M16_C 244..419 CDD:282978 22/127 (17%)
Peptidase_M16_M 436..720 CDD:292805
Peptidase_M16_C 724..907 CDD:282978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.