DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8728 and Ide

DIOPT Version :9

Sequence 1:NP_610333.1 Gene:CG8728 / 35748 FlyBaseID:FBgn0033235 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_524182.3 Gene:Ide / 40248 FlyBaseID:FBgn0001247 Length:990 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:111/272 - (40%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SKEIVTHLPPLTEP---LPNLPEAVYAAPLAESAITKVTTLPNGLRI--ASEPRYGQFCTVGLVI 121
            |::..|..|...||   |.|:.::     |.::...:...|.|||::  .|:|. .......|.:
  Fly     7 SQKSATRKPDSMEPILRLNNIEKS-----LQDTRDYRGLQLENGLKVLLISDPN-TDVSAAALSV 65

  Fly   122 DSGPRYEVAYPSGVSHFLEKLAFNSTVNFPNKDAILKELEKNGGICDCQSSRDTLIYAA------ 180
            ..|...:.....|::||.|.:.|..|..:|:::.....|.::||      |.:...|..      
  Fly    66 QVGHMSDPTNLPGLAHFCEHMLFLGTEKYPHENGYTTYLSQSGG------SSNAATYPLMTKYHF 124

  Fly   181 -----SIDSRAIDSVTRLLADVTLRPTLSDQEVSLARRAVNFE----LETLGMRPEQ------EP 230
                 .:|. |:|...:........|:.:::|::    |||.|    |.:...|.:|      :|
  Fly   125 HVAPDKLDG-ALDRFAQFFIAPLFTPSATEREIN----AVNSEHEKNLPSDLWRIKQVNRHLAKP 184

  Fly   231 ILMDMIHAAAFRDNTLGLPKLCPLENLDHINRNVLMNYLKYHHSPKRMVIAGVGVDH-DELVSHV 294
               |..::.....|...|.::...:|:|  .|:.|:.:.|..:|...|.:|.:|.:. |||...|
  Fly   185 ---DHAYSKFGSGNKTTLSEIPKSKNID--VRDELLKFHKQWYSANIMCLAVIGKESLDELEGMV 244

  Fly   295 QRYF--VEDKAI 304
            ...|  :|:|.:
  Fly   245 LEKFSEIENKNV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8728NP_610333.1 PqqL 76..532 CDD:223685 55/255 (22%)
Peptidase_M16 104..253 CDD:279066 32/171 (19%)
Peptidase_M16_C 259..461 CDD:282978 14/49 (29%)
IdeNP_524182.3 Ptr 25..952 CDD:223956 54/254 (21%)
Peptidase_M16 47..185 CDD:279066 29/152 (19%)
Peptidase_M16_C 211..386 CDD:282978 14/46 (30%)
Peptidase_M16_M 395..676 CDD:292805
Peptidase_M16_C 680..863 CDD:282978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.