DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8728 and CG3107

DIOPT Version :9

Sequence 1:NP_610333.1 Gene:CG8728 / 35748 FlyBaseID:FBgn0033235 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001036470.1 Gene:CG3107 / 35475 FlyBaseID:FBgn0033005 Length:1034 Species:Drosophila melanogaster


Alignment Length:250 Identity:50/250 - (20%)
Similarity:90/250 - (36%) Gaps:69/250 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SGVSHFLEKLAFNSTVNFPNKDAILKELEKN-GGICDCQSSRDTLIYAAS----IDSRAIDSVTR 192
            :|:.|.||.|:...:..:|.:|...|.|.:: ....:..:..|..||..|    ||.|   ::..
  Fly   124 TGLPHILEHLSLCGSQKYPVRDPFFKMLNRSVATFMNAMTGPDYTIYPFSTMNEIDFR---NLQH 185

  Fly   193 LLADVTLRPTLS-----------------DQEVSLARRAVNFELETLGMRPEQEPILMDMIHAAA 240
            :..|...||.|:                 |::..|..:.|.:. |..|...|...:....:....
  Fly   186 IYLDAVFRPNLAYFDFLQEGWRLENKDIFDKQSKLVIKGVVYN-EMKGAFSENAQVFSQNLLNNI 249

  Fly   241 FRDNT---------LGLPKLCPLENLDHINRNVLMNYLKYHHSPKRMVIAGVGV-DHDELVSHVQ 295
            |.|:|         |.:|||.         .|.|:.:.|.::.|....|...|: |..:.::.:.
  Fly   250 FPDHTYRHVSGGNPLEIPKLA---------YNDLVEFHKKYYHPSNARIYSYGLFDASKTLALLD 305

  Fly   296 RYFVEDKAIWETEALEDSGPKQVDTSIAQYTGGLVKEQCEIPIYAAAGLPELAHV 350
            ..::.|:: |            ||.|.:     |:::|      .....|.|.|:
  Fly   306 EEYLSDQS-W------------VDNSYS-----LIRQQ------ERWTQPRLVHI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8728NP_610333.1 PqqL 76..532 CDD:223685 50/249 (20%)
Peptidase_M16 104..253 CDD:279066 33/150 (22%)
Peptidase_M16_C 259..461 CDD:282978 17/92 (18%)
CG3107NP_001036470.1 Cym1 68..1003 CDD:223957 50/249 (20%)
Peptidase_M16 120..>177 CDD:279066 13/52 (25%)
Peptidase_M16_C 268..457 CDD:282978 19/101 (19%)
M16C_assoc 531..773 CDD:285556
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.