DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drosha and NFD2

DIOPT Version :9

Sequence 1:NP_477436.1 Gene:drosha / 35747 FlyBaseID:FBgn0026722 Length:1327 Species:Drosophila melanogaster
Sequence 2:NP_173854.1 Gene:NFD2 / 839061 AraportID:AT1G24450 Length:191 Species:Arabidopsis thaliana


Alignment Length:214 Identity:41/214 - (19%)
Similarity:69/214 - (32%) Gaps:84/214 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   739 FHKSLDLLEESIGYRFKNRYLLQLALTHPSYKENYGTNPDHARNSLTNCGIRQPEYGDRKIHYMN 803
            |...|..|:..|||:|.|..||:.|:||.|:.:.                               
plant    44 FATDLAKLQTQIGYKFNNINLLRRAMTHASFSQE------------------------------- 77

  Fly   804 TRKRGINTLVSIMSRFGKEHETVSNITHNERLEFLGDAVVEFLSSIHLFFMFPELEEGGLATYR- 867
                                       :|:.|...|..::|  :::.|.|:..:::....|..| 
plant    78 ---------------------------NNKALSIFGTHIIE--TAVSLQFLAKDIDISSKALGRL 113

  Fly   868 AAIVQN--QHLALLAKKLQLEEFMLYAHGSDLCHELELRHAMANC--FEALMGALLLDGGIKVAD 928
            .:.|.|  ...||...:|.|.:.:..:..:|..:...|      |  |.|:.||:.:|.|     
plant   114 ISEVSNVESSCALDGDRLGLGKIIRVSTKTDASNSAIL------CTGFRAIFGAIAIDAG----- 167

  Fly   929 EVFTDALFRQDEKLLSIWK 947
                    ..||.:...||
plant   168 --------TVDEAIKVFWK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
droshaNP_477436.1 DLL_N 64..136 CDD:289198
Rnc 738..>974 CDD:223644 41/214 (19%)
RIBOc 826..942 CDD:197778 25/120 (21%)
rnc 973..1196 CDD:234633
RIBOc 990..1117 CDD:197778
DSRM 1125..1196 CDD:238007
NFD2NP_173854.1 RIBOc 63..187 CDD:197778 33/195 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.