DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drosha and RTL2

DIOPT Version :9

Sequence 1:NP_477436.1 Gene:drosha / 35747 FlyBaseID:FBgn0026722 Length:1327 Species:Drosophila melanogaster
Sequence 2:NP_566661.1 Gene:RTL2 / 821587 AraportID:AT3G20420 Length:391 Species:Arabidopsis thaliana


Alignment Length:330 Identity:80/330 - (24%)
Similarity:117/330 - (35%) Gaps:96/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   944 SIWKNLPEHPLQEQEPLGDRSCIDSYRVLKELTKFEDSIGI----------------KFKHIRLL 992
            |:..:||..|   ..||  .|..|.:|....|:....|:.:                ||.:..||
plant    18 SLSNSLPHRP---PSPL--PSSADIHRFYNSLSPSAPSVPVSSEMESMEAVEKILNYKFSNKSLL 77

  Fly   993 ARAFTDRSIGFTHLTLGSNQRLEFLGDTVLQLICSEYLYRHFPEHHEGHLSLLRSSLVNNRTQAV 1057
            ..|.|..|.    ....|.:||||:||:.:.|..|.|||..:|......|||||::.|:....|.
plant    78 KEAITHTSC----TDFPSYERLEFIGDSAIGLAISNYLYLTYPSLEPHDLSLLRAANVSTEKLAR 138

  Fly  1058 VCDDLGMPKYAVYANPKADLKTKD------------------------RADLLEAFLGALYVD-- 1096
            |..:.|:..:.....|..|.|.|:                        .|||.|:..||:|||  
plant   139 VSLNHGLYSFLRRNAPSLDEKVKEFSEAVGKEDDLSVSYGGLVKAPKVLADLFESLAGAVYVDVN 203

  Fly  1097 ----------KGLLYCEQFCHVCLFPRLQLFIMNQDWNDPKSKLQQCCLTLRTMDGGEPDIPYYK 1151
                      :|||.          |.:.|..: |....|.|.|.:.|            ..:.|
plant   204 FDLQRLWVIFRGLLE----------PIVTLDDL-QKQPQPVSMLFKLC------------HKHKK 245

  Fly  1152 VVEASGPTNTRVYKVAVYFRSKRLATSSGSSIQQAEMNAAKQALENSRDLFP------------Q 1204
            .::.....:..|....:|...:.||:....:...|.:.|||:||....::||            |
plant   246 RIDIKNWKDGNVSIAVIYLDDELLASGRAENKDIARLIAAKEALRKLSEVFPVEMVIDEDSVEIQ 310

  Fly  1205 LDHQK 1209
            |.|.|
plant   311 LTHAK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
droshaNP_477436.1 DLL_N 64..136 CDD:289198
Rnc 738..>974 CDD:223644 9/29 (31%)
RIBOc 826..942 CDD:197778
rnc 973..1196 CDD:234633 64/274 (23%)
RIBOc 990..1117 CDD:197778 44/162 (27%)
DSRM 1125..1196 CDD:238007 14/70 (20%)
RTL2NP_566661.1 Rnc 54..294 CDD:223644 63/266 (24%)
RIBOc 75..226 CDD:238333 45/164 (27%)
dsrm 232..292 CDD:278464 15/71 (21%)
DSRM 313..385 CDD:238007 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D935825at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.