DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drosha and mrpl44

DIOPT Version :9

Sequence 1:NP_477436.1 Gene:drosha / 35747 FlyBaseID:FBgn0026722 Length:1327 Species:Drosophila melanogaster
Sequence 2:NP_001025431.2 Gene:mrpl44 / 571210 ZFINID:ZDB-GENE-050913-59 Length:332 Species:Danio rerio


Alignment Length:173 Identity:41/173 - (23%)
Similarity:73/173 - (42%) Gaps:32/173 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   855 FPELEEGGLATYRAAIVQNQHLALLAKKLQLEEFMLYAHGSDLCHELEL-RHAMANCFEALMGAL 918
            ||.|.:.|:|.....:..::.:..:|:.|.:||..:.|       |..: .|.:...|.|::|||
Zfish   143 FPNLPDEGVAAIAGHLTGSEVICHVARNLAVEELTMSA-------EFPVPDHILQGTFFAVIGAL 200

  Fly   919 LLDGGIKVADEVFTDALFRQ--DEKLLSIWKNLPEHPLQEQEPLGDRSCIDSYRVLKELTKFEDS 981
            ....|...|.....|.|..|  .:.|..:||.:        :|:|        .:::|||:    
Zfish   201 EQSSGPVRAGLFIRDFLVTQLIGKDLFDMWKVV--------DPMG--------LLVEELTR---- 245

  Fly   982 IGIKFKHIRLLARAFTDRSIGFTHLTLGSNQRL--EFLGDTVL 1022
            .|:.....||:..|.....:....:.|.|:::|  :..|:|||
Zfish   246 KGVALPEPRLIRSAGASTVLPLYFVGLYSDRKLLAQGPGETVL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
droshaNP_477436.1 DLL_N 64..136 CDD:289198
Rnc 738..>974 CDD:223644 27/121 (22%)
RIBOc 826..942 CDD:197778 22/89 (25%)
rnc 973..1196 CDD:234633 14/52 (27%)
RIBOc 990..1117 CDD:197778 10/35 (29%)
DSRM 1125..1196 CDD:238007
mrpl44NP_001025431.2 Rnc <143..303 CDD:223644 41/173 (24%)
DSRM 234..302 CDD:294045 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.