DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drosha and mRpL44

DIOPT Version :9

Sequence 1:NP_477436.1 Gene:drosha / 35747 FlyBaseID:FBgn0026722 Length:1327 Species:Drosophila melanogaster
Sequence 2:NP_649541.1 Gene:mRpL44 / 40656 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster


Alignment Length:280 Identity:63/280 - (22%)
Similarity:111/280 - (39%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   957 QEPLGD-----RSCIDSYRVLKELTKFEDSIGIKFKHIRLLARAFTDRS-------------IGF 1003
            |:.||.     ||....:....||..|...:|..|: :..|.||||::|             |..
  Fly    44 QKKLGPQKPERRSGFVEWNQRSELFAFGKRLGESFE-LSELQRAFTEKSFAEREEDRRRQLGIEE 107

  Fly  1004 THLTLGSNQRLEFLGDTVLQLICSEYLYRHFPEHHEGHLSLLRSSLVNNRTQAVVCDDLGMPKYA 1068
            :.|.:..|..|...|..:.:.....:|....|:.....|..:.|.|::..|.|.|...|| .|..
  Fly   108 SDLQMPHNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLAHVSTHLG-TKDL 171

  Fly  1069 VYAN---PKADLKTKDRADLLEAFLGALY----VDKGLLYCEQFCHVCLFPRLQLFIMNQDW--N 1124
            :.:.   |.|:.:.|.    |.|.:|||.    :::..::...|  :|  .:|....:.:.|  .
  Fly   172 IQSTEYPPSAESQAKS----LHAVIGALASSSGIERAFIFVRDF--IC--TQLNQKDLLEVWTPQ 228

  Fly  1125 DPKSKLQQCCLTLRTMDGGEPDIPYYKVVEASGPTNTRVYKVAVYFRSKRLATSSGSSIQQAEMN 1189
            :|...|::.|.. |.:...||.:    :.:....|....|:|.:|...:.|....|..::.|...
  Fly   229 EPIQLLEKICQE-RKLGEAEPRL----LGDCGKNTVLAAYQVGIYANRQLLGKGFGEDVKTATET 288

  Fly  1190 AAKQALENSRDLFPQLDHQK 1209
            ||..||::   :|...|:::
  Fly   289 AALDALQS---IFDTRDNRR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
droshaNP_477436.1 DLL_N 64..136 CDD:289198
Rnc 738..>974 CDD:223644 5/21 (24%)
RIBOc 826..942 CDD:197778
rnc 973..1196 CDD:234633 55/244 (23%)
RIBOc 990..1117 CDD:197778 33/146 (23%)
DSRM 1125..1196 CDD:238007 16/70 (23%)
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 53/238 (22%)
RIBOc 81..219 CDD:197778 33/146 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11207
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.