DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drosha and mrpl3

DIOPT Version :9

Sequence 1:NP_477436.1 Gene:drosha / 35747 FlyBaseID:FBgn0026722 Length:1327 Species:Drosophila melanogaster
Sequence 2:NP_596672.1 Gene:mrpl3 / 2541040 PomBaseID:SPBC3B9.14c Length:326 Species:Schizosaccharomyces pombe


Alignment Length:262 Identity:54/262 - (20%)
Similarity:101/262 - (38%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   960 LGDRSCIDSYRVLKELTKFEDSIGIKFKHIRLLARAFTDRSIGFTHLTLGSNQRLEFLGDTVLQL 1024
            |..:..|.....||:.....:|..:|     :|.:|..|:::  ......||::|..:|......
pombe    38 LSSKIAISKVYTLKKRIGLPESYPMK-----VLVQALIDKTV--VQNPQYSNEKLWSIGKVFGDF 95

  Fly  1025 ICSEYLYRHFPEHHEGHLSLLRSSLVNNRTQAVVCDDLGM--------------PKYAVYANPKA 1075
            ...||:...:|...|..:..:::..:.::..:.:....|:              ...|..|:|:.
pombe    96 YVLEYIKCKYPRLPEEAVHGMQNGWMGSKALSQLATIWGLEVQRREEGLQESFGKVLAKRADPEM 160

  Fly  1076 DLKT----KDRA--DLLEAFLGALYVDKGLLYCEQFC--HVC---LFPRLQLFIMNQDWNDPKSK 1129
            ..|.    ||.|  ..:.|.||.:|:.:|....::|.  |:.   |.||..|.:   .|  |:.:
pombe   161 LRKPGEIYKDEAARRAILAILGGVYLHQGFNDTKKFINDHILSKQLDPRTMLQL---QW--PRRQ 220

  Fly  1130 LQQCCLTLRTMDGGEPDIPYYKVVEASG-PTNTRVYKVAVYFRSKRLATSSGSSIQQAEMNAAKQ 1193
            |.:.|..|...:      |.|:::..:| .:...|:.:..|.....|.....||:..||..||..
pombe   221 LSRLCKRLSLKE------PVYRIIAETGRKSREPVFVIGAYSGHHLLGQGQASSLNLAEQQAAYN 279

  Fly  1194 AL 1195
            :|
pombe   280 SL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
droshaNP_477436.1 DLL_N 64..136 CDD:289198
Rnc 738..>974 CDD:223644 3/13 (23%)
RIBOc 826..942 CDD:197778
rnc 973..1196 CDD:234633 51/249 (20%)
RIBOc 990..1117 CDD:197778 29/151 (19%)
DSRM 1125..1196 CDD:238007 17/72 (24%)
mrpl3NP_596672.1 Rnc 40..290 CDD:223644 53/260 (20%)
RIBOc 65..209 CDD:197778 27/145 (19%)
DSRM 217..285 CDD:214634 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.