DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnh1 and T09F3.5

DIOPT Version :9

Sequence 1:NP_477315.1 Gene:rnh1 / 35746 FlyBaseID:FBgn0023171 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001022338.1 Gene:T09F3.5 / 3565885 WormBaseID:WBGene00011664 Length:528 Species:Caenorhabditis elegans


Alignment Length:210 Identity:53/210 - (25%)
Similarity:85/210 - (40%) Gaps:45/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PRHASQVSEATGLKQ----VGAFQFEIDAEGYVIVYTDGSCIGNGRAGACAGYGVYFGKNHQLNA 214
            ||..|.....:.::|    :|.| ..:|..||....:.|..|        |.||:|:||:...|.
 Worm    30 PRRESFREFTSNMEQNEANLGKF-VRVDTTGYSFTDSTGKRI--------AKYGIYWGKDDTRNG 85

  Fly   215 AKPVEGRVTNNVGEIQAAIHAIKTALDLG-IQKLCISTDSQFLINSITLW--VAGWKKRDWKLKN 276
            .:.:....:|....:.|.:.||..|.:.. ...|.|.:|   |:.|.||.  ::||.|||:.|:|
 Worm    86 IRTLPDGASNVAAMLTAILEAINVAREEDPPPSLLIYSD---LLTSDTLLRDLSGWAKRDFYLRN 147

  Fly   277 NQ-PVKNVVDFKELDKLLQ-----------------ENNITVK-----WNYVEAHKGIEGNEMAD 318
            .: .:||.....:|...:|                 :|.:|:.     ...|:.|| :|..|...
 Worm   148 QEAKMKNSEILHDLFLAVQGLHLKIVHKPSITPEDPKNRVTIAIMEGIVKKVQDHK-VEKLETKR 211

  Fly   319 KLARQGSALYKQKNG 333
            :....|:.|  .|||
 Worm   212 EEIEIGTTL--DKNG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnh1NP_477315.1 Cauli_VI 19..60 CDD:279957
RNase_HI_eukaryote_like 183..326 CDD:260012 40/168 (24%)
T09F3.5NP_001022338.1 RNase_H_like 62..174 CDD:301345 32/122 (26%)
RNase_H_like 236..>319 CDD:301345
RNase_H_like <434..>503 CDD:301345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0328
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10642
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.