DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnh1 and rnh-1.3

DIOPT Version :9

Sequence 1:NP_477315.1 Gene:rnh1 / 35746 FlyBaseID:FBgn0023171 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_492581.1 Gene:rnh-1.3 / 182229 WormBaseID:WBGene00007303 Length:139 Species:Caenorhabditis elegans


Alignment Length:128 Identity:44/128 - (34%)
Similarity:69/128 - (53%) Gaps:4/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 YTDGSCIGNGRAGACAGYGVYFGKNHQLNAAKPV-EGRVTNNVGEIQAAIHAIKTALDLGIQKLC 248
            |||||.:|||:.|:..||||:...:...|.:... .|..|||..|::|..||.:.|.|:....:.
 Worm     6 YTDGSALGNGQQGSRGGYGVHVPSDTSKNVSGSYPHGPQTNNRYELEAIKHATQMARDVPDSHVR 70

  Fly   249 ISTDSQFLINSITLWVAGWKKRDWKLKNNQPVKNVVDFKELDK---LLQENNITVKWNYVEAH 308
            |.|||:...:|:|.|...||...:|..:.|.|||....:::|:   .|:.:..||::.:|..|
 Worm    71 IHTDSKNAKDSVTKWNDNWKSNGYKTSSGQDVKNQDLIRDIDRNVQALKHSGKTVEFEHVRGH 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnh1NP_477315.1 Cauli_VI 19..60 CDD:279957
RNase_HI_eukaryote_like 183..326 CDD:260012 44/128 (34%)
rnh-1.3NP_492581.1 RNase_HI_eukaryote_like 6..135 CDD:260012 44/128 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0328
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2771
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434144at2759
OrthoFinder 1 1.000 - - FOG0003232
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101549
Panther 1 1.100 - - O PTHR10642
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1165
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.