DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnh1 and T09F3.4

DIOPT Version :9

Sequence 1:NP_477315.1 Gene:rnh1 / 35746 FlyBaseID:FBgn0023171 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_496238.2 Gene:T09F3.4 / 174605 WormBaseID:WBGene00011663 Length:223 Species:Caenorhabditis elegans


Alignment Length:124 Identity:25/124 - (20%)
Similarity:46/124 - (37%) Gaps:37/124 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FCWNLQRCTMAFYAVASGRRSGVYGSWAECEEQVKGFKNAKYKKFKTRQEADQFVNGCKSYAPQD 71
            ||.::..|:..|                 .||:::.....|.:..:...:|.|.|...:|:|...
 Worm     8 FCSSIPSCSQRF-----------------TEEELQAIIELKRRSERILDKAAQNVLKGRSWAKAP 55

  Fly    72 VAVPLGKEKASLASWKNSIEVNKNPKYTDE------------WPEEDHDLAEDDLNAAM 118
            |....|::..  |||:.|.:  |..::.|:            |.    |.||.|::..:
 Worm    56 VLEVSGRKPP--ASWQRSSK--KGQRFFDQNEQIQQSVVKLRWA----DFAERDVDVLL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnh1NP_477315.1 Cauli_VI 19..60 CDD:279957 4/40 (10%)
RNase_HI_eukaryote_like 183..326 CDD:260012
T09F3.4NP_496238.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0328
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10642
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.