DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnh1 and LOC100493932

DIOPT Version :9

Sequence 1:NP_477315.1 Gene:rnh1 / 35746 FlyBaseID:FBgn0023171 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_002935076.2 Gene:LOC100493932 / 100493932 -ID:- Length:204 Species:Xenopus tropicalis


Alignment Length:307 Identity:91/307 - (29%)
Similarity:122/307 - (39%) Gaps:107/307 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YAVASGRRSGVYGSWAECEEQVKGFKNAKYKKFKTRQEADQFVNGCKSYAPQDVAVPLGKEKASL 83
            |||..||:.|||.:|.||.|||..:..|.::|..|.:||..|....:.|:|...|   |:     
 Frog     3 YAVRRGRQVGVYDTWEECREQVDRYPYASFRKLPTYREARNFARSNERYSPYSSA---GR----- 59

  Fly    84 ASWKNSIEVNKNPKYTDEWPEEDHDLAEDDLNAAMNEVEGDPKPSNSSNLPDILNRKRKGTTSGD 148
                                                                             
 Frog    60 ----------------------------------------------------------------- 59

  Fly   149 KRNKIPRHASQVSEATGLKQVGAFQFEIDAEGYVIVYTDGSCIGNGRAGACAGYGVYFGKNHQLN 213
                                        .||    |||||.|..||:.||..|.|||:|.....|
 Frog    60 ----------------------------SAE----VYTDGCCYRNGQYGANGGIGVYWGPEDSRN 92

  Fly   214 AAKPVEGRVTNNVGEIQAAIHAIKTALDLGIQKLCISTDSQFLINSITLWVAGWKKRDWKLKNNQ 278
            .:..::||.||...||:||..|::.|.|..|..|.|:|||:|.|..:|.||..||:..||..:.:
 Frog    93 VSAKLKGRQTNQRAEIEAACTAVEQARDDNITSLNINTDSRFTIKGMTQWVPRWKENGWKTIDGR 157

  Fly   279 PVKNVVDFKELDKLLQENNITVKWNYVEAHKGIEGNEMADKLARQGS 325
            .|.|..||::|||..:  |:.:|||||..|.|..||:.||:||:.||
 Frog   158 DVINKQDFQKLDKACE--NMDIKWNYVPGHSGSVGNDRADQLAKAGS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnh1NP_477315.1 Cauli_VI 19..60 CDD:279957 19/40 (48%)
RNase_HI_eukaryote_like 183..326 CDD:260012 65/143 (45%)
LOC100493932XP_002935076.2 Cauli_VI 3..44 CDD:396314 19/40 (48%)
RNase_HI_eukaryote_like 63..203 CDD:260012 65/142 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434144at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1165
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.