DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS12 and VHT1

DIOPT Version :9

Sequence 1:NP_610332.3 Gene:MFS12 / 35745 FlyBaseID:FBgn0033234 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_011579.1 Gene:VHT1 / 852956 SGDID:S000003297 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:457 Identity:89/457 - (19%)
Similarity:153/457 - (33%) Gaps:142/457 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GYVVSQVPAGLLAKRFGAKLVLGLATAIGGILCFFHPIAAKSGW----------QSICVLRVLTG 127
            |.:|.|:|...|..||.:.::|              |: ...||          .|:..||....
Yeast   176 GAIVFQLPFMYLLPRFPSHIIL--------------PV-MDLGWTWFTFACYRANSLAELRAYRF 225

  Fly   128 LVQ---GTVYPCVHTLLAKWVPRTERGLLTTGVYSGAQFGTAVILVTSGF----IFES------S 179
            ::.   ...||....:|..|....|........:.|.|.|:    ||||.    ||:|      .
Yeast   226 ILSAFGAAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGS----VTSGLLQSRIFKSLNGVHGL 286

  Fly   180 MGWPGLFYLSG-GLSLAWALLFFWQAANEP--------------VTASRISKGEVEYIESLTGSN 229
            .||..:|.:.. .:||..|::.|:.....|              :..:|..:.:::        :
Yeast   287 AGWRWMFLIDAIAISLPTAIIGFFVIPGVPSKCYSLFLTDEEIRIARARNKRNQIK--------D 343

  Fly   230 SSSQSMPVP------WMSIFRSPAFYGLLAAH-CGFTW-------GFYTLLTEMPTYMSMVLQLN 280
            ...:|...|      |..:|.:|||:.|:... |  :|       |.|||..:..|..| :.|:|
Yeast   344 GVDKSKLAPLWSRKLWKKVFCTPAFWVLVVFDTC--SWNNMTAYSGSYTLWLKSNTKYS-IAQVN 405

  Fly   281 VKSNAFLSSLPY---FAMGLLCFVVSPISDLLINRGTISITTARKLFNSIGQWGPMACLIGLGYM 342
                 .||.:|.   ||..:.|...   :||...:....:..|  :.|::      :|.:.:.:.
Yeast   406 -----NLSVIPACLGFAYVIFCAFG---ADLFRCKWIFMVFAA--IMNTV------SCALLIKWD 454

  Fly   343 TADEKTWAILLLTLAVGINAGCSCGYLINHIDLSPNFAGPMMGVTNGIAGVTSIIAPLVVGAIVS 407
            ...:..|.....|......:.|...::.:.:...|.           :..:|.|       ||.|
Yeast   455 IPSKAKWYAFFTTYFSVAASPCLWSFINDFLRFDPQ-----------VKAITWI-------AIYS 501

  Fly   408 DEEDPSQWRMVF---------FITGGIYLVCNTIFVIFGKATIQIWNEPPSTSSTMTLRSHQEND 463
            ..:....|....         |.||      .|:.:||| |...:|       :.:.|..::.|:
Yeast   502 FSQSTYAWIPTLAWPTVESPRFKTG------YTVSLIFG-AIYGLW-------TFVVLFFYKRNE 552

  Fly   464 SK 465
            .|
Yeast   553 KK 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS12NP_610332.3 MFS 23..436 CDD:119392 81/426 (19%)
2A0114euk 25..447 CDD:129972 86/437 (20%)
VHT1NP_011579.1 MFS_FEN2_like 124..542 CDD:340885 86/443 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.