DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS12 and FEN2

DIOPT Version :9

Sequence 1:NP_610332.3 Gene:MFS12 / 35745 FlyBaseID:FBgn0033234 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_009957.1 Gene:FEN2 / 850394 SGDID:S000000623 Length:512 Species:Saccharomyces cerevisiae


Alignment Length:454 Identity:94/454 - (20%)
Similarity:165/454 - (36%) Gaps:110/454 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLLFVGMM--INYFQRVNISAAIVPMTQ---STAGAPFYTWDTSDKSLILSSFFWGYVVSQVPAG 82
            ||.||.:.  |||..||..:.|.:...:   ...|        :|.::..:.|..||:|..||..
Yeast    37 VLSFVCLQYWINYVDRVGFTNAYISGMKEDLKMVG--------NDLTVSNTVFMIGYIVGMVPNN 93

  Fly    83 LLAKRFGAKLVLGLATAIGGILCFFHPIAAKSGWQSICVLRVLTGLVQGTVYPCVHTLLAKWVPR 147
            |:......::.|...|...|:|..  .:...:.::.||.:|....|.:...:...|.:|..|...
Yeast    94 LMLLCVPPRIWLSFCTFAWGLLTL--GMYKVTSFKHICAIRFFQALFESCTFSGTHFVLGSWYKE 156

  Fly   148 TE---RGLLTTGV-YSGAQFGTAVILVTSGFIFESSM----------GWPGLFYLSGGLSLAWAL 198
            .|   |..:.||. ..|:.|        |||:..|..          ||..||.:...::|..|:
Yeast   157 DELPIRSAIFTGSGLVGSMF--------SGFMQTSIFTHLNGRNGLAGWRWLFIIDFCITLPIAI 213

  Fly   199 LFFWQAANEPVTASRISK-GEVEYIESLTGSNSSSQSMP-------VPWMSIFRSPA-----FYG 250
            ..|......|...|.:|| ....||.:....:.:.:.:|       :.|.:|.|...     .:.
Yeast   214 YGFIFFPGLPDQTSAVSKFSMTRYIFNEQELHYARRRLPARDESTRLDWSTIPRVLKRWHWWMFS 278

  Fly   251 LLAAHCGFTWGF--------------YTLLTEMPTYMSMVLQLNVKSN----AFLSSLP---YFA 294
            |:....|...||              || |.:...|.|.:..:.:.|.    .::|.:|   ::.
Yeast   279 LVWVLGGENLGFASNSTFALWLQNQKYT-LAQRNNYPSGIFAVGIVSTLCSAVYMSKIPRARHWH 342

  Fly   295 MGLLCFVVSPISDLLINRGTISITTARKLFNS--------IGQ-----WGPMACLIGLGYMTADE 346
            :.:...:|..|..:||....::   .:.:|::        .||     |..:.|       .||.
Yeast   343 VSVFISLVMVIVAVLIRADPLN---PKVVFSAQYLGGVAYAGQAVFFSWANIIC-------HADL 397

  Fly   347 KTWAILLLTLAV---GINAGCSCGYLINHIDLSPNFAGPMMGVTNGIAGVTSIIAPLVVGAIVS 407
            :..||:|.::.:   .:||..|..:..:  |:.|.|.          .|..:::|..:...|||
Yeast   398 QERAIVLASMNMFSGAVNAWWSILFFAS--DMVPKFE----------RGCYALLATAISSGIVS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS12NP_610332.3 MFS 23..436 CDD:119392 94/454 (21%)
2A0114euk 25..447 CDD:129972 92/452 (20%)
FEN2NP_009957.1 MFS_FEN2_like 32..450 CDD:340885 94/454 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.