DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS12 and Slc17a9

DIOPT Version :9

Sequence 1:NP_610332.3 Gene:MFS12 / 35745 FlyBaseID:FBgn0033234 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:363 Identity:102/363 - (28%)
Similarity:158/363 - (43%) Gaps:89/363 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEDK--ARPGGLGVRHWQAVLLFVGMMINYFQRVNISAAIVPMTQSTAGAPFYTWDTSDKSLILS 68
            :|||  :||   ..:.|..:|| :|..:.|..||.:....|.|:|.      :.|:..:..::||
  Rat    24 AEDKRWSRP---ECQLWTGMLL-LGTCLLYCTRVTMPVCTVAMSQD------FGWNKKEAGIVLS 78

  Fly    69 SFFWGYVVSQVPAGLLAKRFGAKLVLGLATAIGGILCFFHPIAAKSGWQSICVL---RVLTGLVQ 130
            ||||||.::||..|.|..|.|.:.|:.|:.:..|.:....|:.|..|...:..:   |:||||:|
  Rat    79 SFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGFITVTTPLLAHLGSGHLAFVTFSRILTGLLQ 143

  Fly   131 GTVYPCVHTLLAKWVPRTERGLLTTGVYSGAQFGTAVILVTSGF--IFESSMGWPGLFYLSGGLS 193
            |..:|.:.:||::.|..:||....:.|.:|:|.||   |||.|.  :.....||..:||.||||:
  Rat   144 GVYFPALTSLLSQRVQESERSFTYSTVGAGSQVGT---LVTGGIGSVLLDRCGWQSVFYFSGGLT 205

  Fly   194 LAWALLFFWQAANE--------------PVTASRISKGEVEYIESLTGSNSSSQSMPVPWMSIFR 244
            |.|....:....:|              |||  |.||                    |||..:||
  Rat   206 LLWVYYVYKYLLDEKDLVLALGVLAQGLPVT--RPSK--------------------VPWRQLFR 248

  Fly   245 SPAFYGLLAAHCGFTWGFYTLLTEMPTYMSMVLQLNVKSNAFLSSLPYFAMGLLCFVVSP----- 304
            ..:.:.::.:.......|:.||:.:||:             |..:.|: :.|.: |.|.|     
  Rat   249 KASVWAVICSQLSSACSFFILLSWLPTF-------------FKETFPH-SKGWV-FNVVPWLLAI 298

  Fly   305 --------ISDLLINRGTISITTARKLFNSI----GQW 330
                    |||.||::| ..:.|.||.....    |.|
  Rat   299 PASLFSGFISDRLISQG-YRVITVRKFMQPCPAGHGPW 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS12NP_610332.3 MFS 23..436 CDD:119392 96/344 (28%)
2A0114euk 25..447 CDD:129972 95/342 (28%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 94/335 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.