DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS12 and ZK54.3

DIOPT Version :9

Sequence 1:NP_610332.3 Gene:MFS12 / 35745 FlyBaseID:FBgn0033234 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001379785.1 Gene:ZK54.3 / 266895 WormBaseID:WBGene00022648 Length:89 Species:Caenorhabditis elegans


Alignment Length:95 Identity:18/95 - (18%)
Similarity:34/95 - (35%) Gaps:32/95 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 PMMGVTNGIAGVTSIIAPLVVGAIVSDEEDPSQWRMVFFITGGIYLVCNTIFVIFGKATIQIWNE 446
            |:..::|   |.|..|            :|..:|:....:         .:..:||.|.|.    
 Worm     7 PLRPLSN---GTTEAI------------DDSKRWKRRHLV---------AVLAMFGFAFIY---- 43

  Fly   447 PPSTSSTM--TLRSHQENDSKSIVPTSDKD 474
              .|..|:  |....::..:|:.:|.|.:|
 Worm    44 --GTQITLSNTFMEDEQKVNKTKIPDSHED 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS12NP_610332.3 MFS 23..436 CDD:119392 7/53 (13%)
2A0114euk 25..447 CDD:129972 11/64 (17%)
ZK54.3NP_001379785.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.