DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS12 and SLC17A8

DIOPT Version :9

Sequence 1:NP_610332.3 Gene:MFS12 / 35745 FlyBaseID:FBgn0033234 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_647480.1 Gene:SLC17A8 / 246213 HGNCID:20151 Length:589 Species:Homo sapiens


Alignment Length:450 Identity:134/450 - (29%)
Similarity:224/450 - (49%) Gaps:16/450 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLGVRHWQAVLLFVGMMINYFQRVNISAAIVPMTQSTA----GAP-----FYTWDTSDKSLILSS 69
            ||..|:..|::..:|..|::..|.|:..|||.|..::.    |.|     .:.||.....||..|
Human    71 GLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTAQFNWDPETVGLIHGS 135

  Fly    70 FFWGYVVSQVPAGLLAKRFGAKLVLGLATAIGGILCFFHPIAAKSGWQSICVLRVLTGLVQGTVY 134
            |||||:::|:|.|.::.:|.|..|.|.|..:...|..|.|.||:..:..:..:|:|.|||:|..|
Human   136 FFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTY 200

  Fly   135 PCVHTLLAKWVPRTERGLLTTGVYSGAQFGTAVILVTSGFIFESSMGWPGLFYLSGGLSLAWALL 199
            |..|.:.:||.|..||..|.|..:.|:..|..|.:..:|.:.: .:||..:||:.|...:.|.:.
Human   201 PACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQ-YIGWSSVFYIYGMFGIIWYMF 264

  Fly   200 FFWQAANEPVTASRISKGEVEYIESLTGSNSSSQSM---PVPWMSIFRSPAFYGLLAAHCGFTWG 261
            :..||...|.....||..|..|||:..|..::..|:   ..||...|.|...|.::.|:...:|.
Human   265 WLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWT 329

  Fly   262 FYTLLTEMPTYMSMVLQLNVKSNAFLSSLPYFAMGLLCFVVSPISDLLINRGTISITTARKLFNS 326
            ||.||...|.|...|....:.....||::|:..|.::..:...::|.|.:|..::.|..||:.|.
Human   330 FYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNC 394

  Fly   327 IGQWGPMACLIGLGYMTADEKTWAILLLTLAVGINAGCSCGYLINHIDLSPNFAGPMMGVTNGIA 391
            .|.......|:.:|:  :..|..||..|.||||.:.....|:.:||:|::|.:|..:||::||:.
Human   395 GGFGMEATLLLVVGF--SHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVG 457

  Fly   392 GVTSIIAPLVVGAIVSDEEDPSQWRMVFFITGGIYLVCNTIFVIFGKATIQIWNEPPSTS 451
            .::.::.||:||| ::..:...:|:.||.|...::......:.:|.....|.|.:|.:.|
Human   458 TLSGMVCPLIVGA-MTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLS 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS12NP_610332.3 MFS 23..436 CDD:119392 125/424 (29%)
2A0114euk 25..447 CDD:129972 128/433 (30%)
SLC17A8NP_647480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..61
2A0114euk 75..513 CDD:129972 130/441 (29%)
MFS 80..502 CDD:119392 125/425 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.