DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS12 and Y19D10A.5

DIOPT Version :9

Sequence 1:NP_610332.3 Gene:MFS12 / 35745 FlyBaseID:FBgn0033234 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_503656.2 Gene:Y19D10A.5 / 189483 WormBaseID:WBGene00021220 Length:478 Species:Caenorhabditis elegans


Alignment Length:418 Identity:111/418 - (26%)
Similarity:186/418 - (44%) Gaps:37/418 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 W--DTSDKSLILSSFFWGYVVSQVPAGLLAKRFGAKLVL---GLATAIGGILCFFHPIAAKSGWQ 117
            |  |::.|||:.||...|.::..:.|..|..|.|.:|||   |:.:.:|.||   .|:|.:..:.
 Worm    79 WFEDSNMKSLVFSSMAVGGLLGLLIAMPLMHRVGVRLVLSICGVFSILGTIL---FPLAVEWNFF 140

  Fly   118 SICVLRVLTGLVQGTVYPCVHTLLAKWVPRTERGLLTTGVYSGAQFGTAVILVTSGFIFESSMGW 182
            |:.|:|.|.||....|:..:.::...|.|..|.|.....:....|:...:.:..|||:.|||.||
 Worm   141 SVLVVRFLQGLGISMVFTVLGSVPTAWAPNNESGTFLAVLSCAFQWSNVICMPISGFLCESSWGW 205

  Fly   183 PGLFYLSGGLSLAWALLFFWQAANEPVTASRISKGEVEYIESLTGSNSSSQSMPVPWMSIFRSPA 247
            ..::||.|.:::.:.|.|::...:.|.....:|..|:..|   ....:.:...|||:::|.:.|.
 Worm   206 RSIYYLFGIVTIVFFLAFYFFYTDSPTDHRNVSNKELSLI---LQDKTVTHKEPVPYLAICKDPC 267

  Fly   248 FYGLLAAHCGFTWGFYTLLTEMPTYMSMVLQLNVKSNAFLSSLPYFAMGLLCFVVSPISDLLINR 312
            ......::.|...||.||:...|||:..||...|:...|.|:||:    ||...|..|:..|.:|
 Worm   268 VLVTWMSNIGGNLGFLTLVLYGPTYLREVLNFEVRGTGFASALPF----LLSAAVKSIAGQLSDR 328

  Fly   313 GTISITTARKLFNSIGQWGPMACLIG-LGYMTADEKTWAILLLTLAVGINAGCSCGYLINHIDL- 375
              ....:.|..|...|....:...|| :|..|...:..|.:..|.::.: :|.:....:..:.| 
 Worm   329 --CDFVSERVRFTICGIVARLGLAIGYIGMATTSSRLVAQIAFTFSIAV-SGLNIMGTVKCLQLR 390

  Fly   376 ---SPNFAGPMMGVTNGIAGVTSIIAPLVVGAIVSDEEDPSQWRMVFFITGGIYLVCNTIFVIFG 437
               ..:||..::.:   :|.|....||::|| |:..:....||...|.|.|.|..|.:..|..|.
 Worm   391 CKQHVHFAVSVIAL---MAYVIQFGAPILVG-IICPDNTAEQWGWFFLIVGIIVFVTSAPFPWFT 451

  Fly   438 KATIQIWNEPP----STSSTMTLRSHQE 461
            .|      ||.    |....:.:..|:|
 Worm   452 TA------EPADYTLSREKQLEIAKHKE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS12NP_610332.3 MFS 23..436 CDD:119392 104/387 (27%)
2A0114euk 25..447 CDD:129972 106/398 (27%)
Y19D10A.5NP_503656.2 MFS 56..443 CDD:391944 102/380 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.