DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS12 and F11A5.9

DIOPT Version :9

Sequence 1:NP_610332.3 Gene:MFS12 / 35745 FlyBaseID:FBgn0033234 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_507089.2 Gene:F11A5.9 / 180085 WormBaseID:WBGene00008677 Length:519 Species:Caenorhabditis elegans


Alignment Length:408 Identity:90/408 - (22%)
Similarity:177/408 - (43%) Gaps:39/408 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YTWDTSDKSLILSSFFWGYVVSQVPAGLLAKRFGAKLV---LGLATAIGGILCFFHPIAAKSGWQ 117
            |.:..|:|||:.|....|.:|:..|..||.::||::.:   :|:.:.:...|.   |..|..|:.
 Worm   102 YNYSPSEKSLLFSLVAVGAMVAVYPVMLLIQKFGSRSIVFWVGMLSTVSTALI---PWMAYIGFW 163

  Fly   118 SICVLRVLTGLVQGTVYPCVHTLLAKWVPRTERGLLTTGVYSGAQFGTAVILVTSGFIFESSMGW 182
            .:.|:|...|....|.:..:..:..:|..:.:.......:.:..|.|....:..:|.:..||:||
 Worm   164 PLLVMRFFQGAGLSTSFTLIGIVTRQWSMQVQSAFYIAVLTTFFQIGPIFTMPVAGALCTSSLGW 228

  Fly   183 PGLFYLSGGLSLAWALLFFWQAANEPVTASRISKGEVEYIESLTGSNSSSQSMPVPWMSIFRSPA 247
            |.::|:...::....:||::.....||..:.:|..|:|.|:...|.....   .||..:|...|.
 Worm   229 PAVYYIHAVVTFGLFVLFYFFYRENPVRHALVSTKELEKIQRGKGDGKRE---AVPIKAILTDPV 290

  Fly   248 FYGLLAAHCGFTWGFYTLLTEMPTYMSMVLQLNVKSNAFLSSLPYFAMGLLCFVVSPISDLLINR 312
            .:.:..:..|...|....:...|||::.|:...|:.....|::|.    ::.|.:..|:....::
 Worm   291 IWSIWISAIGNFMGIQLTMQFSPTYLNKVMGFAVEQTGTFSAIPQ----IVTFFLKVIAGYAADK 351

  Fly   313 G-TISITTARKLFNSIGQWGPMACLIGLGYMTADEKTWAILLLTLAVGINAGCSCGYLI------ 370
            . ..:..|:.|::|::...|.....:||..:...|....:.:|..:..| .|.:||...      
 Worm   352 ARCCTPQTSVKIYNNLALGGMSLSFLGLAVIPVSEPVLGLCMLIFSCSI-IGFNCGAFFRSSAIY 415

  Fly   371 ----NHIDLSPNFAGPMMGVTNGIAGVTSIIAPLVVGAIVSDEEDPSQW--RMVFFITGGIYLVC 429
                ||.         :|||.:.:..:.:::||::|...|:::.....|  .||.|:|   ..|.
 Worm   416 AAQHNHF---------IMGVNSFLNCLAALLAPVIVNIFVANDTWDEWWWVWMVHFVT---LFVF 468

  Fly   430 NTIFVIFGKATIQIWNEP 447
            |.:|.|:||.....|::|
 Worm   469 NIVFQIYGKGVPAEWSKP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS12NP_610332.3 MFS 23..436 CDD:119392 85/395 (22%)
2A0114euk 25..447 CDD:129972 89/406 (22%)
F11A5.9NP_507089.2 2A0114euk 27..486 CDD:129972 89/406 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.