powered by:
Protein Alignment MFS12 and T05H10.3
DIOPT Version :9
Sequence 1: | NP_610332.3 |
Gene: | MFS12 / 35745 |
FlyBaseID: | FBgn0033234 |
Length: | 477 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495688.1 |
Gene: | T05H10.3 / 174292 |
WormBaseID: | WBGene00011508 |
Length: | 158 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 10/50 - (20%) |
Similarity: | 19/50 - (38%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 VYPCVHTLLAKWVPRTERGLLTTGVYSGAQFGTAVILVTSGFIFESSMGW 182
|.|..||:...::.:..|.......|...:.....:|..||....|::.:
Worm 78 VCPKSHTVFISYIDQGHRACFNFITYQVEKRNDEHVLWRSGKCLNSTVNY 127
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
MFS12 | NP_610332.3 |
MFS |
23..436 |
CDD:119392 |
10/49 (20%) |
2A0114euk |
25..447 |
CDD:129972 |
10/49 (20%) |
T05H10.3 | NP_495688.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2532 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.