DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and JADE3

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001070913.1 Gene:JADE3 / 9767 HGNCID:22982 Length:823 Species:Homo sapiens


Alignment Length:190 Identity:43/190 - (22%)
Similarity:63/190 - (33%) Gaps:62/190 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ASICRCRSDMVKISMETFVRRFQPERYDNWLKG-----QDMGCHPEEPGKICAAAPPTLNEYEK- 368
            ||:||...|    .|:.|           ||:.     .:|||.|.:...:    ..|:...|: 
Human   133 ASVCRYDLD----DMDIF-----------WLQELNEDLAEMGCGPVDENLM----EKTVEVLERH 178

  Fly   369 -QENLRAAKSEEESPQKRGCSLAGNGCE----------RNAESAEDVD----DKASVSSYSSCRQ 418
             .||:..|...||          |.|.|          |:.:|.|..|    ||.:|..:.:|..
Human   179 CHENMNHAIETEE----------GLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVHQACYG 233

  Fly   419 LQPVVK---------LRKLPTIASVPEPSSAPKRYDFNTEAVVRVKRLW---NELPCPDR 466
            :..|.:         |...|.....|:...|.|.....|:.......||   ..:.||:|
Human   234 ILKVPEGSWLCRSCVLGIYPQCVLCPKKGGALKTTKTGTKWAHVSCALWIPEVSIACPER 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224
JADE3NP_001070913.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
EPL1 <88..177 CDD:287484 14/62 (23%)
PHD_JADE3 202..251 CDD:277151 10/48 (21%)
ePHD_JADE3 255..365 CDD:277176 9/39 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..576
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 609..630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 650..684
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.