DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and PHF14

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001007158.1 Gene:PHF14 / 9678 HGNCID:22203 Length:948 Species:Homo sapiens


Alignment Length:98 Identity:25/98 - (25%)
Similarity:38/98 - (38%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 EYEKQENLRAAKSEEESPQKRGCSLAGNGCERNAESAEDVD-DKASVSS--YSSCRQLQPVVKLR 426
            |.|..|..|..|.:|:..:|          |:..|...:.: :||:||.  .:|.....|.....
Human   104 EEENGERPRKKKEKEKEKEK----------EKEKEKEREKEKEKATVSENVAASAAATTPATSPP 158

  Fly   427 KLPTIASVPEPSSAPKRYDFNTEAVVRVKRLWN 459
            .:.|..|||..::|       ||..|...:.||
Human   159 AVNTSPSVPTTTTA-------TEEQVSEPKKWN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224
PHF14NP_001007158.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..302 25/98 (26%)
PHD1_PHF14 321..377 CDD:277036
ePHD_PHF14 385..498 CDD:277144
PHD2_PHF14 727..776 CDD:277037
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 812..867
PHD3_PHF14 870..918 CDD:277038
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.