DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and SNT2

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_011384.1 Gene:SNT2 / 852746 SGDID:S000003099 Length:1403 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:50/272 - (18%)
Similarity:91/272 - (33%) Gaps:87/272 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKITQEAGEIMITFPFGYHAGFN 287
            |.:..|..|:||..        ||:.:.:::.| |.::|.|..|..:...:|.::.|....    
Yeast   928 GFKFVKFDNKTFQR--------LRNSLKLVNNK-LPKYNEPSTKKIKMINDIALSNPLNEP---- 979

  Fly   288 HGFNGAESTNFASKRWIEYGKRASICRCRSDMVKISMETFVRRFQPERYDNWLKGQDMGCHPEEP 352
               ||| |.|:..   |.:.|..|:..                   |:|.:..|          |
Yeast   980 ---NGA-SYNYTV---ISHSKETSVAL-------------------EKYHDGNK----------P 1008

  Fly   353 GKICAAAPPTLNEYEKQENLRAAKSEEESPQ--------KRGCSLAGNGCERNAESAEDVDDKAS 409
            .|:          .||...|:..|::.::|.        :..||:.......| ::.|.|.....
Yeast  1009 SKM----------LEKDMILKHTKNKPKNPDTAWANNSARTFCSVCKEKFNDN-DNYEVVCGNCG 1062

  Fly   410 VSSYSSCRQLQPVVKLRK------------------LPTIASVPEPSSAP-KRYDFNTEAVVRVK 455
            ::.:..|..::....::|                  .|.|::..:.|..| |.||::.......|
Yeast  1063 LTVHYFCYAIKLPKDMKKNTNLKTFKWLCDPCSNDLNPIISTTYQCSMCPTKDYDYDRYRSQSFK 1127

  Fly   456 RLWNELPCPDRG 467
            ...:.|.|...|
Yeast  1128 ICPDALKCTSLG 1139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224 18/74 (24%)
SNT2NP_011384.1 BAH_fungalPHD 112..256 CDD:240061
PHD1_Snt2p_like 319..366 CDD:276972
Myb_DNA-binding 559..602 CDD:395191
PHD2_Snt2p_like 1040..1094 CDD:276973 7/54 (13%)
ePHD_Snt2p_like 1108..1248 CDD:277137 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.