DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and JMJ18

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001185118.1 Gene:JMJ18 / 839963 AraportID:AT1G30810 Length:819 Species:Arabidopsis thaliana


Alignment Length:481 Identity:132/481 - (27%)
Similarity:191/481 - (39%) Gaps:132/481 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DEEQ----NKVPRIMTFRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVP-----RKSGY 64
            ||.|    |..|   .|.||.|||.:..||||.|... |...|:.:|.||:.|.|     .||.:
plant    49 DEAQRPIINDAP---VFTPSLEEFVDPLAYIEKIRPL-AEPYGICRIIPPSTWKPPCRLKEKSIW 109

  Fly    65 D-------IDNINM--------------------------------TIPAPICQVVTGAHGVYQQ 90
            :       |..:::                                :.||.    .|.:....::
plant   110 EQTKFPTRIQTVDLLQNREPMKKKPKSRKRKRRRNSRMGSSKRRSGSSPAE----STSSPEAEEK 170

  Fly    91 INIQQRRQMTLRQFMEKANSELHQTPRHFD--------------YDDLERKYWKNITY----ISP 137
            .........||.:|.:.|   ||....:|:              .||:|.:||:.:..    :..
plant   171 FGFNSGSDFTLDEFEKYA---LHFKDSYFEKKDSGGDIVKWTPSVDDIEGEYWRIVEQPTDEVEV 232

  Fly   138 LYAADVKGSL--------------SDED---LDVWNIGRLDTILNLVNTDYNIIIDGVNTAYLYF 185
            .|.||::..:              ||.:   |..||:..|..:...|.:..:..|.||...:||.
plant   233 YYGADLENGVLGSGFYKRAEKFTGSDMEQYTLSGWNLNNLPRLPGSVLSFEDCDISGVLVPWLYV 297

  Fly   186 GMWKSSFAWHTEDMDLYSINYLHFGAPKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMT 250
            ||..|||.||.||..|||:||.|||.||.||.:|.:....|||...:...:.::|....|...:|
plant   298 GMCFSSFCWHVEDHHLYSLNYHHFGEPKVWYGVPGSNATALEKAMRKHLPDLFEEQPDLLHGLVT 362

  Fly   251 MISPKVLRQHNIPYNKITQEAGEIMITFPFGYHAGFNHGFNGAESTNFASKRWIEYGKRASICRC 315
            ..||.:|:...:...::.|.:||.::|||..||||||.|||.||:.|.|...|:.:|:.|     
plant   363 QFSPSILKDEGVQAYRVVQNSGEYVLTFPRAYHAGFNCGFNCAEAVNVAPVDWLAHGQNA----- 422

  Fly   316 RSDMVKI-SMETFVRRFQPERYDNWLKGQDMGCHPEEPGKICAAAPPTLNEYEKQE---NLRAAK 376
                |:: |.||   |.....:|..|.|               ||      ||..:   .|.|::
plant   423 ----VELYSKET---RKTSLSHDKLLLG---------------AA------YEAVKALWELSASE 459

  Fly   377 SEEESPQKRGCSLAG-NGCERNAESA 401
            .:|.:...|..|..| ||...||..|
plant   460 GKENTTNLRWKSFCGKNGTLTNAIQA 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 17/41 (41%)
JmjC 182..298 CDD:202224 50/115 (43%)
JMJ18NP_001185118.1 JmjN 59..99 CDD:128818 18/43 (42%)
JmjC 294..410 CDD:396791 50/115 (43%)
zf-C5HC2 519..571 CDD:397190
FYRN 658..702 CDD:128814
FYRC 708..794 CDD:197781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2177
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.920

Return to query results.
Submit another query.