DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and ELF6

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_196044.2 Gene:ELF6 / 830303 AraportID:AT5G04240 Length:1340 Species:Arabidopsis thaliana


Alignment Length:637 Identity:144/637 - (22%)
Similarity:222/637 - (34%) Gaps:254/637 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VPRIMTFRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVPRKS-GYDIDNINMTI----- 73
            :|....|||:..||.:..|||..|| :.|...|:.||.||   :|:.| .|...|:|.::     
plant    13 LPLAPVFRPTDTEFADPIAYISKIE-KEASAFGICKIIPP---LPKPSKKYVFYNLNKSLLKCPE 73

  Fly    74 ---PAPICQVVTGAHGVYQQINIQQRRQMTLRQFME-------KANS------ELHQTPRHFDYD 122
               ...|.:|......|:      ..||..|.|.::       |:||      ::.|:...:..|
plant    74 LVSDVDISKVCKEDRAVF------TTRQQELGQTVKKNKGEKGKSNSQRSGVKQVWQSGGVYTLD 132

  Fly   123 DLERK-----------------------YWK----NITYISPLYAADVKG--------------- 145
            ..|.|                       :||    ...||.  ||.||.|               
plant   133 QFEAKSKAFYKTQLGTVKELAPVVIEALFWKAALEKPIYIE--YANDVPGSAFGEPEDHFRHFRQ 195

  Fly   146 --------------------------------------SLSDED------LDV------------ 154
                                                  |||.:|      :|:            
plant   196 RKRRGRGFYQRKTENNDPSGKNGEKSSPEVEKAPLASTSLSSQDSSKQKNMDIVDEMEGTAGWKL 260

  Fly   155 ----WNIGRL----DTILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWHTEDMDLYSINYLHFGA 211
                ||:..:    .::...:..|    |.||.:..:|.||..|.||||.||.:|:|:||||.|:
plant   261 SNSSWNLQMIARSPGSVTRFMPDD----IPGVTSPMVYIGMLFSWFAWHVEDHELHSMNYLHTGS 321

  Fly   212 PKTWYAIP-------------PAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIP 263
            ||||||:|             .:|||.:::||..|          .|..|.|::||:::....||
plant   322 PKTWYAVPCDYALDFEEVIRKNSYGRNIDQLAALT----------QLGEKTTLVSPEMIVASGIP 376

  Fly   264 YNKITQEAGEIMITFPFGYHAGFNHGFNGAESTNFASKRWIEYGKRASICRC---------RSDM 319
            ..::.|..||.::|||..||.||:||||..|:.||.:.:|:...|.|::.|.         ...:
plant   377 CCRLVQNPGEFVVTFPRSYHVGFSHGFNCGEAANFGTPQWLNVAKEAAVRRAAMNYLPMLSHQQL 441

  Fly   320 VKISMETFVRRF----------------QPERYDNWLK----------GQDMGCHPEEPGK---- 354
            :.:...:||.|.                |.|..:..:|          .:::.....|||.    
plant   442 LYLLTMSFVSRVPRSLLPGGRSSRLRDRQREEREFLVKRAFVEDILNENKNLSVLLREPGSRLVM 506

  Fly   355 ---------------------ICAAAPPTLNEYEKQENLRAAKSEEESPQKRGCSLAGNGCERNA 398
                                 ..|.:||.:.:.|.:|.....:::|::......||.       .
plant   507 WDPDLLPRHSALALAAAGVAGASAVSPPAVAKKELEEGHSELQNKEKTSLLEELSLF-------M 564

  Fly   399 ESAEDV---DDKASVSSYSSCRQLQPVVKLRKLPTIA---------SVPEPS 438
            |...||   ||...::.:.        |....||.:|         ||.:||
plant   565 EKLNDVYYDDDDGLLNDFQ--------VDTGTLPCVACGVLGFPFMSVVQPS 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 16/41 (39%)
JmjC 182..298 CDD:202224 52/128 (41%)
ELF6NP_196044.2 JmjN 17..50 CDD:396793 14/33 (42%)
JmjC 292..411 CDD:396791 52/128 (41%)
C2H2 Zn finger 1230..1255 CDD:275368
C2H2 Zn finger 1253..1275 CDD:275368
C2H2 Zn finger 1283..1305 CDD:275368
C2H2 Zn finger 1313..1333 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.