DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and REF6

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_680116.2 Gene:REF6 / 824002 AraportID:AT3G48430 Length:1360 Species:Arabidopsis thaliana


Alignment Length:613 Identity:148/613 - (24%)
Similarity:232/613 - (37%) Gaps:175/613 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ADEEQNKVPRIMT------FRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVPRKSGYDI 66
            :::.|:..|.:.:      |||:..|||:..|||..||...:.. |:.||.||..  |......|
plant     4 SEQSQDVFPWLKSLPVAPEFRPTLAEFQDPIAYILKIEEEASRY-GICKILPPLP--PPSKKTSI 65

  Fly    67 DNINMTIPA-PICQVVTGAHGV------------YQQINIQQRRQMTLRQFM-----EKANSELH 113
            .|:|.::.| ...:|..|..|.            .|||....|:|..:::.:     |.:..|..
plant    66 SNLNRSLAARAAARVRDGGFGACDYDGGPTFATRQQQIGFCPRKQRPVQRPVWQSGEEYSFGEFE 130

  Fly   114 QTPRHFDYD--------------DLERKYWKNITYISPL---YAADVKGSL-------------- 147
            ...::|:.:              ::|..||: .|...|.   ||.|:.||.              
plant   131 FKAKNFEKNYLKKCGKKSQLSALEIETLYWR-ATVDKPFSVEYANDMPGSAFIPLSLAAARRRES 194

  Fly   148 SDEDLDV----WNIGRLD----TILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWHTEDMDLYSI 204
            ..|...|    ||:..:.    ::|..:..:    |.||.:..:|..|..|.||||.||.||:|:
plant   195 GGEGGTVGETAWNMRAMSRAEGSLLKFMKEE----IPGVTSPMVYVAMMFSWFAWHVEDHDLHSL 255

  Fly   205 NYLHFGAPKTWYAIPP-------------AYGRRLEKLANETFSENYQECNAYLRHKMTMISPKV 256
            ||||.||.||||.:|.             .||..|..|.  |||.        |..|.|::||:|
plant   256 NYLHMGAGKTWYGVPKDAALAFEEVVRVHGYGEELNPLV--TFST--------LGEKTTVMSPEV 310

  Fly   257 LRQHNIPYNKITQEAGEIMITFPFGYHAGFNHGFNGAESTNFASKRWIEYGKRASICR------- 314
            ..:..||..::.|..||.::|||..||:||:||||..|::|.|:..|:...|.|:|.|       
plant   311 FVKAGIPCCRLVQNPGEFVVTFPGAYHSGFSHGFNFGEASNIATPEWLRMAKDAAIRRAAINYPP 375

  Fly   315 -----------------------------------CRSDMVKISMETFVRRF--QPERYDNWLKG 342
                                               .||:..:::.:.||:..  ..|...:..||
plant   376 MVSHLQLLYDFVLALGSRVPTSINPKPRSSRLKDKARSEGERLTKKLFVQNIIHNNELLSSLGKG 440

  Fly   343 QDMGCHPEEPGKICAAAPPTLNEY--EKQENLRAAKSEEESPQKRGCSLAGNG------------ 393
            ..:...|:....|...:...:..:  ..|||....|.|:.|.......|: ||            
plant   441 SPVALLPQSSSDISVCSDLRIGSHLITNQENPIQLKCEDLSSDSVVVDLS-NGLKDTVSVKEKFT 504

  Fly   394 --CE--RNAESAEDVDDKASVSSYSSCRQLQPVVKL---RKLPTI---------ASVPEPSSAPK 442
              ||  ||..::.:.|.:.::|. :..|:....|.|   |....:         .::.:|..|..
plant   505 SLCERSRNHLASTEKDTQETLSD-AERRKNDAAVALSDQRLFSCVTCGVLSFDCVAIVQPKEAAA 568

  Fly   443 RYDFNTEAVVRVKRLWNELPCPDRGANL 470
            ||..:.:.     ..:|:.......|||
plant   569 RYLMSADC-----SFFNDWTAASGSANL 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 16/47 (34%)
JmjC 182..298 CDD:202224 53/128 (41%)
REF6NP_680116.2 JmjN 21..52 CDD:280526 12/31 (39%)
JmjC 233..352 CDD:202224 53/128 (41%)
C2H2 Zn finger 1245..1266 CDD:275368
C2H2 Zn finger 1268..1290 CDD:275368
C2H2 Zn finger 1298..1320 CDD:275368
C2H2 Zn finger 1328..1348 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.