DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and AT2G38950

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_181429.2 Gene:AT2G38950 / 818480 AraportID:AT2G38950 Length:708 Species:Arabidopsis thaliana


Alignment Length:381 Identity:90/381 - (23%)
Similarity:138/381 - (36%) Gaps:101/381 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVP-------------------------- 59
            |.|:.|||::..:||..:..| |...|:..:.||..|.|                          
plant   111 FNPTEEEFRDTLSYISSLRDR-AEPYGICCVVPPPSWKPPCLLKEKQIWEASTFFPQVQLFGIQT 174

  Fly    60 --RKSGYDID---NINMTIPAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKA----------- 108
              ||...::|   |...:....:|:|..|.             ..||:.|...|           
plant   175 ENRKIKKEVDADSNDAASEGVQLCRVERGP-------------GYTLKSFKNFADTYKKSHFGMK 226

  Fly   109 -------NSELHQTPRHFDYDDLERKYWKNITYISPLYAADVKGSLSDEDLDV------------ 154
                   ||.....|......|:|::|.:.:.  |||...   |.|...|||.            
plant   227 DEVLGSENSSPSLKPNELIVADIEKEYRQIVE--SPLIEI---GVLYGNDLDTATFGSGFPLSAP 286

  Fly   155 ---------WNIGRL----DTILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWHTEDMDLYSINY 206
                     ||:...    .::|:|.:      .:.|....|..||..||..|.:|...|||:.|
plant   287 SESSKYSSGWNLNSTAKLPGSLLSLED------CESVCVPRLSVGMCLSSQFWKSEKERLYSLCY 345

  Fly   207 LHFGAPKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKITQEA 271
            ||.|||:.||::...:..:.:........|...|......:.:.|:||..|....||..:..|..
plant   346 LHVGAPRVWYSVAGCHRSKFKAAMKSFILEMSGEQPKKSHNPVMMMSPYQLSVEGIPVTRCVQHP 410

  Fly   272 GEIMITFPFGYHAGFNHGFNGAESTNFASKRWIEYGKRASICRCRSDMVKISMETF 327
            |:.:|.||..|::.|:.|||..|..|||...|:.:|..|  .:...:|.|.|:.::
plant   411 GQYVIIFPGSYYSAFDCGFNCLEKANFAPLDWLPHGDIA--VQVNQEMSKTSLISY 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 13/37 (35%)
JmjC 182..298 CDD:202224 37/115 (32%)
AT2G38950NP_181429.2 JmjN 107..148 CDD:128818 13/37 (35%)
JmjC 321..437 CDD:202224 37/115 (32%)
zf-C5HC2 544..596 CDD:280996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2177
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.