DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and BRPF1

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_024309509.1 Gene:BRPF1 / 7862 HGNCID:14255 Length:1254 Species:Homo sapiens


Alignment Length:411 Identity:78/411 - (18%)
Similarity:127/411 - (30%) Gaps:165/411 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QQINIQQ-RRQMTLRQFMEKANSELHQTPRHFDYDDLERKYWKNITYISPLYAADVKGSLSDEDL 152
            :.|.:|| ..:|.|..|:......|.|         |:.|              |. |::..|.:
Human   617 ETIKVQQIAMEMQLTPFLILLRKTLEQ---------LQEK--------------DT-GNIFSEPV 657

  Fly   153 DVWNIGRLDTILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWH-------TEDMDLYSINYLHFG 210
            .:..:..||.:     .||   :|.:.....:|.|.::..|:.       .||.:|...|.|.:.
Human   658 PLSEVTELDEV-----PDY---LDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYN 714

  Fly   211 APKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKITQEAGEIM 275
            |..|      .:.|...:|..:                    ...||||       ..::|.::.
Human   715 AKDT------IFYRAAVRLREQ--------------------GGAVLRQ-------ARRQAEKMG 746

  Fly   276 ITFPFGYHAGFNHGFNGAESTNF------------------------------------ASKRWI 304
            |.|..|.|  ..|...|.|:|:.                                    |||:.:
Human   747 IDFETGMH--IPHSLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSV 809

  Fly   305 EYGKRASICRCRSDMVKISMETFVRRFQ---------PERYDNWLKGQDMGCHP---EEPGKICA 357
            ...:||.       |:|..|....|:..         |||:....:| .:..||   ::.|:..:
Human   810 GRSRRAK-------MIKKEMTALRRKLAHQRETGRDGPERHGPSSRG-SLTPHPAACDKDGQTDS 866

  Fly   358 AAPPTLNEYEKQENLRAAKSEEESPQKRGCSLAGNGCERNAESAEDVDDKASVSSYSSCRQLQPV 422
            ||                  ||.|.|:   :..|.|...::..|.:|..:.|            |
Human   867 AA------------------EESSSQE---TSKGLGPNMSSTPAHEVGRRTS------------V 898

  Fly   423 VKLRKLPTIASVPE-PSSAPK 442
            :..:|.|..|..|: |...||
Human   899 LFSKKNPKTAGPPKRPGRPPK 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224 25/122 (20%)
BRPF1XP_024309509.1 SFP1 <20..52 CDD:227516
COG5141 174..657 CDD:227470 13/63 (21%)
ePHD_BRPF1 330..450 CDD:277171
Bromo_brd1_like 632..735 CDD:99944 25/160 (16%)
BR140_related 1123..1238 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.