DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and Jade2

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001344517.1 Gene:Jade2 / 76901 MGIID:1924151 Length:901 Species:Mus musculus


Alignment Length:171 Identity:29/171 - (16%)
Similarity:56/171 - (32%) Gaps:47/171 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 TNFASKRWIEYGKRASICR-CRSDMVKISMETFVRRFQPERYDNWLKGQDMGCHPEEPGKICAAA 359
            ::..:.||   ....|:|: |....::.||.:.:..|.                     ..||  
Mouse   372 SHIPASRW---ALSCSLCKECTGTCIQCSMPSCITAFH---------------------VTCA-- 410

  Fly   360 PPTLNEYEKQENLRAAKSE-EESPQKRGCSLAGNGCERNAESAEDVDDKASVSSYSSCRQLQPVV 423
                  :::...:|...:: :|...|..|....:|..|:..::|.|:...:|.....       |
Mouse   411 ------FDRGLEMRTILADNDEVKFKSLCQEHSDGGPRSEPTSEPVEPSQAVEDLEK-------V 462

  Fly   424 KLRKL------PTIASVPEPSSAPKRYDFNTEAVVRVKRLW 458
            .|||.      .....:.||:...:|.|.....|..:.:.|
Mouse   463 TLRKQRLQQLEENFYELVEPAEVAERLDLAEALVDFIYQYW 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224 0/1 (0%)
Jade2NP_001344517.1 EPL1 209..>578 CDD:331339 29/171 (17%)
ePHD_JADE2 326..436 CDD:277175 14/95 (15%)
Atrophin-1 <676..852 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.