DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and Brpf1

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_006237117.1 Gene:Brpf1 / 679713 RGDID:1584828 Length:1252 Species:Rattus norvegicus


Alignment Length:466 Identity:82/466 - (17%)
Similarity:135/466 - (28%) Gaps:202/466 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QQINIQQ-RRQMTLRQFMEKANSELHQTPRHFDYDDLERKYWKNITYISPLYAADVKGSLSDEDL 152
            :.|.||| ..:|.|..|:......|.|         |:.|              |. |::..|.:
  Rat   616 ETIKIQQIAMEMQLTPFLILLRKTLEQ---------LQEK--------------DT-GNIFSEPV 656

  Fly   153 DVWNIGRLDTILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWH-------TEDMDLYSINYLHFG 210
            .:..:..||.:     .||   :|.:.....:|.|.::..|:.       .||.:|...|.|.:.
  Rat   657 PLSEVTELDEV-----PDY---LDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYN 713

  Fly   211 APKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKITQEAGEIM 275
            |..|      .:.|...:|..:                    ...||||       ..::|.::.
  Rat   714 AKDT------IFYRAAVRLREQ--------------------GGAVLRQ-------ARRQAEKMG 745

  Fly   276 ITFPFGYHAGFNHGFNGAESTNF-----------------------------------ASKRWIE 305
            |.|..|.|  ..|...|.|.::.                                   |||:.:.
  Rat   746 IDFETGMH--IPHNLAGDEVSHHTEDVEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVG 808

  Fly   306 YGKRASICRCRSDMVKISMETFVRRFQPERYDNWLKGQDMGCHPEEPGKICAAAPPTLNEYEKQE 370
            ..:||.       |:|..|....|:.               .|..|.|:                
  Rat   809 RSRRAK-------MIKKEMTALRRKL---------------AHQRETGR---------------- 835

  Fly   371 NLRAAKSEEESPQKRGCSLAGN------GCERNAESAEDVDDKASVSSYSSCRQLQP-------- 421
                     :.|::.|.|..||      .|:::.::....::.   ||..:.:.|.|        
  Rat   836 ---------DGPERHGPSGRGNLTPHPAACDKDGQTDSAAEES---SSQETSKGLGPNMSSTPAH 888

  Fly   422 -------VVKLRKLPTIASVPE-PSSAPKRYDFNTEAVVRVKRLWNELPCPDRGAN------LLT 472
                   |:..:|.|..|..|: |...||    |.|:.:          .|..|.:      |..
  Rat   889 EVGRRTSVLFSKKNPKTAGPPKRPGRPPK----NRESQM----------TPSHGGSPVGPPQLPI 939

  Fly   473 NGVVKNTKRMR 483
            .|.::..||.|
  Rat   940 MGSLRQRKRGR 950

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224 24/122 (20%)
Brpf1XP_006237117.1 EPL1 106..254 CDD:287484
PHD_BRPF1 266..327 CDD:277146
ePHD_BRPF1 329..449 CDD:277171
Bromo_brd1_like 631..734 CDD:99944 25/160 (16%)
BR140_related 1121..1236 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.