DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and kdm4c

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001077320.1 Gene:kdm4c / 570194 ZFINID:ZDB-GENE-070209-38 Length:1482 Species:Danio rerio


Alignment Length:428 Identity:222/428 - (51%)
Similarity:294/428 - (68%) Gaps:28/428 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ADEEQNKVPRIMTFRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVPRKSGYDIDNINMT 72
            |....|...:||||||:.|||::|:.|:.|:||:|||.|||||:.||..|.||::..|||  :..
Zfish     6 ASAPANPACKIMTFRPTMEEFKDFNQYLVYMESQGAHRAGLAKVIPPKGWKPRRNYDDID--DFV 68

  Fly    73 IPAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKANSELHQTPRHFDYDDLERKYWKNITYISP 137
            |.|||.|:|.|..|::.|.|| |::.:|:::|...|||:::.|||:.:|:|||||||||:|::||
Zfish    69 IQAPIQQMVAGQSGLFTQYNI-QKKPLTVQEFRRLANSDMYCTPRYLNYEDLERKYWKNLTFVSP 132

  Fly   138 LYAADVKGSLSDEDLDVWNIGRLDTILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWHTEDMDLY 202
            :|.|||.|:|.|||::.||||.|:::|:::..|..:.|.||||.||||||||:||:|||||||||
Zfish   133 IYGADVSGTLYDEDIEEWNIGHLNSVLDVIEEDCGVSIQGVNTPYLYFGMWKTSFSWHTEDMDLY 197

  Fly   203 SINYLHFGAPKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKI 267
            ||||||||.||:||||||.:|:|||:||...|..:::.|.|:||||||:|||.||::::||::||
Zfish   198 SINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPNSFKSCEAFLRHKMTLISPSVLKKYSIPFDKI 262

  Fly   268 TQEAGEIMITFPFGYHAGFNHGFNGAESTNFASKRWIEYGKRASICRCRSDMVKISMETFVRRFQ 332
            ||||||.|||||:|||||||||||.||||||||.|||:|||.|:.|.|..|||||||:.||||||
Zfish   263 TQEAGEFMITFPYGYHAGFNHGFNCAESTNFASIRWIDYGKLATQCTCSKDMVKISMDPFVRRFQ 327

  Fly   333 PERYDNWLKGQDMGCHPEEPGKICAAAPPTLNEYEKQENLRAAKSEEES-PQKRGCS-------- 388
            |:||:.|.:|:| .|..:.    ....|.|..|.:.....|..|:...| ...|.||        
Zfish   328 PDRYELWTQGKD-SCSLDH----TLPTPSTTPELQSWLQRRRRKTPSTSLHAPRSCSKRLKTVDS 387

  Fly   389 --LAGNG---------CERNAESAEDVDDKASVSSYSS 415
              :.|:|         .:...|..||.......|.|||
Zfish   388 APVKGSGRRSRSAALTAKNKEEEEEDPVKHQKESQYSS 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 25/41 (61%)
JmjC 182..298 CDD:202224 85/115 (74%)
kdm4cNP_001077320.1 JmjN 16..57 CDD:128818 25/40 (63%)
JmjC 177..293 CDD:202224 85/115 (74%)
PHD_SF 1079..1176 CDD:304600
ePHD_JMJD2C 1185..1294 CDD:277185
TUDOR 1308..1364 CDD:197660
TUDOR 1366..1421 CDD:197660
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2716
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1186832at2759
OrthoFinder 1 1.000 - - FOG0000582
OrthoInspector 1 1.000 - - mtm6370
orthoMCL 1 0.900 - - OOG6_100918
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2594
SonicParanoid 1 1.000 - - X490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.