powered by:
Protein Alignment Kdm4A and jade2
DIOPT Version :9
Sequence 1: | NP_610331.1 |
Gene: | Kdm4A / 35744 |
FlyBaseID: | FBgn0033233 |
Length: | 495 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_697831.5 |
Gene: | jade2 / 569359 |
ZFINID: | ZDB-GENE-120215-66 |
Length: | 795 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
Similarity: | 28/70 - (40%) |
Gaps: | 14/70 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 EWVPRKSGYDIDNINMTIPAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKANSELHQTPRHFD 120
|| :.|..:.....|||.|:.:::.....:.....:|.|.| ||:.:....:|
Zfish 83 EW---EKGVQVPANVETIPEPVVRMLPEVSRIPFFSAVQTRSQ-----------SEISEPLSRYD 133
Fly 121 YDDLE 125
.|||:
Zfish 134 LDDLD 138
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5141 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.