DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and jade2

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_697831.5 Gene:jade2 / 569359 ZFINID:ZDB-GENE-120215-66 Length:795 Species:Danio rerio


Alignment Length:70 Identity:16/70 - (22%)
Similarity:28/70 - (40%) Gaps:14/70 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EWVPRKSGYDIDNINMTIPAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKANSELHQTPRHFD 120
            ||   :.|..:.....|||.|:.:::.....:.....:|.|.|           ||:.:....:|
Zfish    83 EW---EKGVQVPANVETIPEPVVRMLPEVSRIPFFSAVQTRSQ-----------SEISEPLSRYD 133

  Fly   121 YDDLE 125
            .|||:
Zfish   134 LDDLD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 2/2 (100%)
JmjC 182..298 CDD:202224
jade2XP_697831.5 COG5141 107..>515 CDD:227470 9/43 (21%)
PHD_JADE2 196..241 CDD:277150
ePHD_JADE2 249..359 CDD:277175
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.